KEGG   Corynebacterium diphtheriae INCA 402: CDB402_0060Help
Entry
CDB402_0060       CDS       T01688                                 

Gene name
opuBB
Definition
(GenBank) choline transport system permease protein
  KO
K05846  osmoprotectant transport system permease protein
Organism
cdh  Corynebacterium diphtheriae INCA 402
Pathway
cdh02010  ABC transporters
Module
cdh_M00209  Osmoprotectant transport system
Brite
KEGG Orthology (KO) [BR:cdh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CDB402_0060 (opuBB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cdh02000]
    CDB402_0060 (opuBB)
Transporters [BR:cdh02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Osmoprotectant transporter [MD:M00209]
    CDB402_0060 (opuBB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AEX45372
Position
complement(63964..64638)
Genome map
AA seq 224 aa AA seqDB search
MTWFGDLLSYLTTAAHWWGSQGFLARLLEHVGISLAAVAIAALLALPAGVLIGHTGRGAG
LVGGVSGAARALPTLGLLTIFGLAFGIGLTAPMLALIILAIPSLLAGAYSGVAAVDRATI
DAAYAMGFTHRQVISSIELPLSAAVLVGGIRTAVLQVTATATLAAYTADVGLGRFIFHGL
KTRDYIEMLAASVLVIALALLFDALLGGAQKLISQRTRTATPAP
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgacttggtttggtgatctcctctcctatctcaccactgccgcgcactggtggggctcg
caaggctttcttgcccgccttctagaacacgttggaatcagcctagctgcggtcgccatt
gccgcactgctcgcccttccggccggtgttctgatcggccatactggccgcggcgccggc
cttgttggtggtgtcagcggtgctgcccgcgcgctgccaaccttgggcttgctcacgatc
tttgggctggcttttggcattggacttacggcaccgatgctggcgctgattattttggcg
atcccatcactgctggctggtgcttattccggcgtggccgccgtagatcgcgcgaccatc
gacgccgcctacgccatgggttttacccaccgccaagtaatcagttccattgagctgcca
ctatctgcagccgtgctggtgggtggcattcgcaccgcagtgttgcaggtgaccgctacg
gccacacttgctgcatataccgcagatgtggggttgggccgatttattttccacggcctc
aaaacgagggattacatcgagatgttggcggcctccgtgctggtgatcgcactcgcgttg
cttttcgacgccctactcgggggcgctcaaaaactgatctctcaacgcacccgcaccgct
acgcctgctccttaa

DBGET integrated database retrieval system