KEGG   Corynebacterium diphtheriae INCA 402: CDB402_0063Help
Entry
CDB402_0063       CDS       T01688                                 

Definition
(GenBank) hypothetical protein
Organism
cdh  Corynebacterium diphtheriae INCA 402
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RskA DUF2157
Motif
Other DBs
NCBI-ProteinID: AEX45375
Position
complement(66117..66725)
Genome map
AA seq 202 aa AA seqDB search
MSNNFPRDIEDALNVSPAPLTPPPALKLSVMDTIAATPQEQPAQSEPEQLATVTPLRRRR
PGLVFASMAASVVLLAGAVTAVYQPWQAADPHAQMDSILAASDVRQADASAMGATLDIVV
SQSMNSGGAMVDGAPAVGHGMGAQVWAVKTDGSMESAGVIGPEEHTDVWMPLPGDTHKVM
ITEEPMAGSTSPRGKVLAEVVV
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacaacttcccccgagatatagaagatgctctcaatgtttcccctgctccgctg
acaccaccaccggcgttgaagctcagcgttatggataccatcgcagctaccccacaggag
cagccagcacagtcggaaccggagcagttggctacggttacgccgttgcgacgccgccgc
ccaggactggtgtttgcgtcgatggctgcgtcggtagtgttgcttgctggtgcggtgaca
gcggtgtatcagccgtggcaggctgcggatccacatgctcaaatggatagcattttggct
gcctctgatgtacgccaggcggatgcgtcggcgatgggtgctacattggatattgtggtg
tcgcagtcgatgaattctggtggtgccatggttgatggtgctcctgcggttgggcacggc
atgggcgcccaagtgtgggcggttaagacggatggttcgatggaatcggctggtgttatt
ggcccggaggaacacactgatgtgtggatgccgttgccgggagatacacacaaggtgatg
attactgaagagcctatggctggtagtacttctccgcgaggaaaggtacttgccgaggtc
gtagtgtag

DBGET integrated database retrieval system