KEGG   Corynebacterium diphtheriae INCA 402: CDB402_0064Help
Entry
CDB402_0064       CDS       T01688                                 

Gene name
sigD
Definition
(GenBank) ECF-family sigma factor D
  KO
K03088  RNA polymerase sigma-70 factor, ECF subfamily
Organism
cdh  Corynebacterium diphtheriae INCA 402
Brite
KEGG Orthology (KO) [BR:cdh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cdh03021]
    CDB402_0064 (sigD)
Transcription machinery [BR:cdh03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     CDB402_0064 (sigD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r2 Sigma70_r4_2 Sigma70_r4 Sigma70_ECF HTH_24 HTH_23 ABM
Motif
Other DBs
NCBI-ProteinID: AEX45376
Position
complement(66722..67282)
Genome map
AA seq 186 aa AA seqDB search
MDPDDLLVAVASGDQAAFAQLYDQLAPYVLGLSTQVIHDRAQAEEVTQEVFVEVWRTAPS
FDASRGSARSWILRLARSRAIDRVRSDIASKKRDTTDFLHSATTWCAAEEEAVESLESQQ
VRALVDSIGEPHRTAIMLSYFQGLTHSEIAEATGVPLGTAKTRLRDGLKKLRQIVHPHLS
ATGAAR
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggatcccgatgatttgctcgtcgcggttgcttctggtgaccaagcggctttcgcgcag
ctttatgaccagctcgcgccctatgttttaggcctgagcactcaggtgattcatgatcgt
gcgcaggcagaggaagtaacccaagaggtttttgtcgaggtgtggcgcactgcgccgagt
ttcgacgcctcccgtggttcggcacggtcgtggattttgcggttggctcggtcgcgggct
attgatcgcgttcgttctgatattgcttcgaaaaagcgcgataccactgattttctccat
agcgccaccacatggtgtgccgctgaggaggaagcggtggagtctttggagtcgcagcag
gttcgtgcgcttgtcgattccattggcgagccacaccggacggccattatgttgtcgtat
ttccaaggtcttactcatagcgagattgcagaggccacgggcgttccgttgggaacagcg
aaaacacggctacgcgacggcttgaaaaaactacgtcagattgttcacccccatttatct
gcgacgggagcagcacgatga

DBGET integrated database retrieval system