KEGG   Corynebacterium diphtheriae INCA 402: CDB402_0065Help
Entry
CDB402_0065       CDS       T01688                                 

Definition
(GenBank) hypothetical protein
Organism
cdh  Corynebacterium diphtheriae INCA 402
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEX45377
Position
complement(67333..67731)
Genome map
AA seq 132 aa AA seqDB search
MDCSQCEKTFFTQPQSVSHRSSEYPYETHREHSWCQPSSKQVIVKHKEYSLMRMTTKAAL
TMMFAAGAFGLAACGDNGTSEKMTSETSTQMSSEKMTPESDKMMESDKMDGKMEHDKMDH
DKMTHESDAMQK
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atggattgctcacaatgcgaaaaaacttttttcacccaaccgcaatccgtttcccatcgg
agctccgaatacccctatgagacacacagggagcactcctggtgtcagccttcaagtaag
caagtaatcgtgaaacacaaggagtattcactcatgcgtatgaccaccaaagcagccctg
accatgatgttcgcagccggcgcattcggccttgcagcctgcggcgataacggcacctcc
gagaagatgacttccgagacaagcacccagatgagctccgagaagatgacacctgaatcc
gacaagatgatggagtcggacaagatggatggaaagatggagcacgacaaaatggatcat
gacaagatgacccacgagtctgacgcaatgcagaagtag

DBGET integrated database retrieval system