KEGG   Corynebacterium diphtheriae INCA 402: CDB402_0071Help
Entry
CDB402_0071       CDS       T01688                                 

Gene name
irp6A
Definition
(GenBank) ferrisiderophore receptor Irp6A
  KO
K02016  iron complex transport system substrate-binding protein
Organism
cdh  Corynebacterium diphtheriae INCA 402
Pathway
cdh02010  ABC transporters
Module
cdh_M00240  Iron complex transport system
Brite
KEGG Orthology (KO) [BR:cdh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CDB402_0071 (irp6A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cdh02000]
    CDB402_0071 (irp6A)
Transporters [BR:cdh02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    CDB402_0071 (irp6A)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_2 LPAM_1 Cyt_bd_oxida_I
Motif
Other DBs
NCBI-ProteinID: AEX45383
Position
72773..73960
Genome map
AA seq 395 aa AA seqDB search
MRLSRKITAVAVAIAASGAALTACSNTSDTATDASATGSSAALTVTDVAGRTVEFDKQPE
RVLLGEGRAMFAASILDKENPGEHIVALGEDLHKAAPSFEAKLFEAHPEIKDIPVIGHIA
KGNVSVENLLAFNPDVVVMTLDHKKAAEQNGFLAKMDQAGMKYVFTDFRQKPLENTTKSV
EVLGAVLGEQDKAKEFNEFYTKKRDDIIARAEKLENKPRTLVWRAAGLKDCCSTVKNSNL
GDLVNAAGGINIGDTLLDTESGDLTAEKVIAEQPEKIIATGGAWAKDPKKPEVLPHVELG
YTATDDVAERTLEGLLKTPGFSTLEAPKKGDLHAVFHQFYDSPYNIFALEQFAQWLQPEE
FKDLDAVKDFKEFHKKWMPFEFSGVFFVTDKVEAK
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtttatccagaaaaattacagctgtggcagtggcaatcgctgccagtggtgctgcg
cttactgcatgcagcaatacatcagacactgcaacggatgcttcagcaactggctcgtct
gcagcactgaccgtcactgacgtcgctggtcgaacggttgaatttgataaacaaccagag
cgcgtgttgctcggcgaaggccgcgccatgtttgctgcctcgatcttggacaaggaaaac
ccaggtgagcacatcgtggccctcggtgaggatctgcacaaagctgcaccgagctttgag
gcgaaactttttgaggctcacccagagatcaaggacatccctgttatcggacacattgct
aagggcaatgtgtctgtagaaaacctgttggctttcaacccagatgttgtggtgatgacc
cttgaccacaagaaggcagccgagcaaaatggcttccttgccaagatggatcaggctggc
atgaagtacgtgtttacggacttccgccagaagccactggaaaacaccaccaagtcggtg
gaggttttgggtgctgttcttggcgagcaggacaaggcaaaggaattcaacgagttctac
accaagaagcgtgacgacatcatcgctcgtgcagagaagttggaaaacaagccacgcacc
ttggtgtggcgtgccgctggtctgaaggactgctgctccacggtgaaaaactccaacctt
ggtgacttggtcaacgctgctggtggcataaacattggcgacactttgctggataccgag
tccggcgacctgaccgctgagaaggttattgctgagcagccagaaaagatcattgcaacc
ggtggcgcttgggcgaaagaccccaagaagcctgaggttcttcctcacgttgagctgggc
tacaccgctaccgatgatgtagcagagcgcaccctcgaaggcctacttaagacccctggc
tttagcaccttggaagctcctaagaagggtgatctgcacgcggtattccaccagttctac
gactccccatacaacatctttgctcttgagcagttcgcacagtggttgcaaccagaggag
ttcaaggatttggatgctgtgaaggacttcaaggagttccacaagaagtggatgccattt
gagttctcgggcgtgttcttcgttaccgacaaggttgaagctaagtaa

DBGET integrated database retrieval system