KEGG   Corynebacterium diphtheriae INCA 402: CDB402_0074Help
Entry
CDB402_0074       CDS       T01688                                 

Definition
(GenBank) putative lipoprotein
Organism
cdh  Corynebacterium diphtheriae INCA 402
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: APOBEC_C
Motif
Other DBs
NCBI-ProteinID: AEX45386
Position
75854..77350
Genome map
AA seq 498 aa AA seqDB search
MRLLKPALVLAIVAGITLSACGSDSATKDISVAGSELSLDKTALVADSSGVEVSQAFFPD
ADKVDSVVVAGSTAQHRWEGAQEAIKRGVPLLVDDSSNTEAINAEIERLGVKDVVRIGDP
AADAQQVAANAAAKKQHTESDHPTDTSMVRQITELSAEHGHLDGGAAVLVSQATSTASVA
TAKASGATVEYLSSGDPRESATLQKDAHAKVVGLGPSFSNLERFHRAVDMLQDPEVPGGG
HLIFPEHRLVALYGHPSGGALGVMGEQPAPEAVVKVKELTEHYAAIDPQTTTVPAFEIIA
TVASADPGPDGNYSNEGTIDELRPWVDEIGKAGGYAVLDLQPGSANFLDQAKQFEELLKL
PHVGLALDPEWRINPGEKPMERVGSVEAAEINSTAEWLTGLVRDNNLPQKPFVVHQFQWQ
MIRGREQLNTTAPELAWILHADGHGPARDKFATWEMMQQDLQPEFTMAWKNFIDEDTPMF
TPEQTMDIYPRPGFVSYQ
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
gtgcgacttcttaagccggcccttgttctcgccattgtggcgggtataacgctttctgcc
tgcggttctgattctgcgacaaaagacatcagcgttgcaggcagtgagctgtccttagat
aaaacagcgctggttgcggattcttctggggtggaggtttcgcaagcgtttttccctgat
gccgacaaagtagattcggttgtggtggcaggtagcaccgcgcagcaccgctgggaggga
gcacaagaggccattaagcgcggggtcccgttgcttgtcgacgactcctccaacaccgag
gccatcaatgccgagatcgaacggcttggggtaaaagatgtggttcgcattggtgatcca
gcagccgacgcccagcaagtggcggccaacgcagctgctaagaaacaacacaccgaatcg
gatcatccgaccgataccagcatggtacgccagatcactgagctttctgcagaacatggt
caccttgatggtggggcagcggtgttggtgtcacaggcgacgtcgacagctagtgttgcc
accgccaaagcctccggcgccaccgtggaatacctctcttcaggtgacccacgtgaatcc
gctactttgcaaaaagatgcccacgccaaagtggtgggcttaggaccgagctttagcaac
ctagagcgcttccaccgcgcggtagatatgctgcaggacccagaagtcccaggtggtgga
cacttgattttccctgaacatcgcctcgtcgctttatatggtcacccctctggcggtgca
ctcggtgtgatgggcgaacaacctgctccggaggcagtggtcaaggtaaaagagcttact
gagcactatgccgccatcgatccgcagaccaccaccgtgcctgcttttgaaattattgcc
accgtagccagcgcagaccctggcccagacggcaactactctaacgagggcaccattgat
gagctgcgtccgtgggtagacgagatcggtaaagcgggcggatatgcggtccttgatctg
cagccaggcagcgcgaacttcctcgaccaagccaagcagttcgaggagctgctcaagctt
ccgcacgtggggcttgctcttgaccccgagtggcggatcaacccaggtgaaaagcccatg
gagcgggtgggaagtgttgaggccgctgagattaatagcacggctgagtggcttactggc
cttgttcgcgataacaacctgccgcaaaagccctttgtggtgcaccagttccagtggcag
atgatccgtggtcgtgagcagcttaataccaccgcccctgagttggcgtggattctgcac
gctgacggtcatggtccggcgcgcgataagtttgccacttgggagatgatgcagcaggat
ctgcagccggagttcactatggcgtggaagaactttattgatgaggacaccccgatgttt
accccagagcaaactatggatatttatccgcgcccagggtttgtctcctatcaataa

DBGET integrated database retrieval system