KEGG   Corynebacterium diphtheriae INCA 402: CDB402_0077Help
Entry
CDB402_0077       CDS       T01688                                 

Definition
(GenBank) putative membrane protein
Organism
cdh  Corynebacterium diphtheriae INCA 402
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2871
Motif
Other DBs
NCBI-ProteinID: AEX45389
Position
79153..79572
Genome map
AA seq 139 aa AA seqDB search
MRKLYYASLTYLILGLVAGVFYREWTKVFNAVDRSQLNTLHTHLLVLGTFFFLIVLVLDK
VFHLSGQKKFQQWFIFHNVALAWTTLAMLANGIVATSGGMWGPAQSGIAGMGHILLTGGF
IWFFSMLNTAIKRSEANQK
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaactgtattatgcctcgttaacctacctcattctcgggcttgtagccggggtg
ttctaccgtgaatggactaaggtgttcaacgccgtggaccgctctcaactcaacaccttg
cacacccacctcctcgtgctaggaaccttcttcttcctcatcgtattggtgctagacaag
gtgtttcacctctctggccaaaagaaattccagcagtggttcatcttccacaacgtagcc
ctagcatggaccaccctcgccatgctggccaacggcatcgtagctaccagcggcggcatg
tggggcccagcccaatcgggtatcgctggcatgggccacatcctgctcaccggcggtttc
atctggttcttcagcatgctcaacaccgcgatcaagcgcagcgaagctaaccagaaataa

DBGET integrated database retrieval system