KEGG   Corynebacterium diphtheriae INCA 402: CDB402_0079Help
Entry
CDB402_0079       CDS       T01688                                 

Definition
(GenBank) putative membrane protein
  KO
K22736  vacuolar iron transporter family protein
Organism
cdh  Corynebacterium diphtheriae INCA 402
Brite
KEGG Orthology (KO) [BR:cdh00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cdh02000]
    CDB402_0079
Transporters [BR:cdh02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   CDB402_0079
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VIT1
Motif
Other DBs
NCBI-ProteinID: AEX45391
Position
complement(80873..81631)
Genome map
AA seq 252 aa AA seqDB search
MTQKNFPPLPGTLSSTGSAIDPVAVSGLNSKLNWLRAGILGANDGIVSISALLLGVIATN
AGTSTVLLSGVAATIAGAVSMALGEFVSVSAQRDNEHKVMEQEYNELLHAPGEERAEIAG
ILENYGMSTATAYRAAIEIGRNDPFRAHLQIEYGIDPHDLTSPLHAAVSSAASFLLGALL
PLLTVFLIPDLSRVAGAIAVTAVTLLALAITGYISARIGGTSPVKSVLRLTIGGILGLAL
TFGAGYAFGAVA
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaaaagaatttcccaccattgccagggaccctctcctccacaggctcagccata
gacccagtggcagtatcggggctcaactccaagctgaactggctacgcgccggcatcctc
ggagctaacgacggcattgtgtccatctctgccctgctacttggtgtgatcgctaccaac
gccggcacctccacggtgctgctttccggtgtggcagccaccatcgccggtgccgtatcc
atggcactaggcgaatttgtgtctgtgtctgcccagcgcgacaacgagcacaaggtcatg
gagcaggaatacaacgagcttctgcacgctccaggtgaagagcgcgcagaaatcgctggg
atccttgaaaactacggcatgagcactgccactgcgtatcgtgccgccattgagattggt
cgcaacgatcccttccgtgcccacctgcaaatcgagtacggtattgatccccatgacctc
accagcccacttcatgctgcggtgtcctcggcagcatcctttctgctcggcgcactgctg
ccactgctcacggtcttcttgatcccagatctctcccgcgtggccggcgcgattgccgta
actgccgtcaccttgctggccttggctattaccggttatatctcagcgcgtatcggcggc
acctcgcctgtgaagtcagtactgcgcctgaccatcggtggcattctcggcttggcactg
actttcggtgccggttatgccttcggcgcggtagcctag

DBGET integrated database retrieval system