KEGG   Corynebacterium diphtheriae INCA 402: CDB402_0080Help
Entry
CDB402_0080       CDS       T01688                                 

Definition
(GenBank) putative lipase
  KO
K01046  triacylglycerol lipase [EC:3.1.1.3]
Organism
cdh  Corynebacterium diphtheriae INCA 402
Pathway
cdh00561  Glycerolipid metabolism
cdh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    CDB402_0080
Enzymes [BR:cdh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     CDB402_0080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_6 Lipase_2 Palm_thioest Abhydrolase_1 PGAP1 Hydrolase_4 DUF2974 DUF915 Abhydrolase_2 Chlorophyllase2 DUF676 LCAT Chlorophyllase Thioesterase Abhydrolase_5 DUF3089
Motif
Other DBs
NCBI-ProteinID: AEX45392
Position
complement(81726..82508)
Genome map
AA seq 260 aa AA seqDB search
MAVVQHHLPLSARLPARGIFEDDWRDRPSKRHPYPVILIHGTGVTKGDWMELGHTLRSLG
YAVWAPDFGMRSTAAVAESAAQVGAYIDAVLTVTKAKKAIVVGHSQGGILARYWMHNLGG
ADKVSHLISLAVPHHGTSHGGMMSPLGRTPRGTAVIDSLITGFFGASGFEMLHDSELIAQ
LNEHGDTLPYVYYSCIATRSDTIIQPVESCFLHGKLVRNIYAQAVSKHAIILHEDMPHDP
RVRRLVIAEIERVERLTIPS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcagttgtccagcatcacctgccgctttctgcccgcctgccagcccgtggaatcttc
gaggacgactggcgcgatcggccgtcgaaacgccacccctatcccgtcatcctgatccac
ggaacgggagtcaccaaaggcgattggatggagctcgggcacacacttcgcagcctaggt
tatgccgtgtgggcaccggattttgggatgcgctccaccgcagccgtagcggaatccgcc
gcccaagtaggcgcatatatcgacgccgttttgaccgtcaccaaggccaagaaagcgatt
gtggtggggcattcgcaaggcgggattttggcacgctattggatgcacaacctcggcggt
gcggacaaagtaagccacctcatttcacttgcggtcccccaccacggcacctcccacggc
ggaatgatgagcccgctggggcgcacaccgcgtggtaccgcagtgatcgattcccttatc
accggattttttggagctagtggttttgaaatgctgcacgatagcgagctcattgcgcag
ctcaatgagcatggcgacaccctgccgtacgtgtattacagctgcattgccacccgttcc
gacaccattatccagccggtagaatcctgcttcctccatggaaaacttgtgcgcaatatt
tatgcgcaagcagtatctaagcacgcgatcattttgcacgaggacatgccccacgatccg
cgggtacggcgcctcgtcattgcagagatagaaagagtggaaaggctaactatccccagc
taa

DBGET integrated database retrieval system