KEGG   Corynebacterium diphtheriae INCA 402: CDB402_0086Help
Entry
CDB402_0086       CDS       T01688                                 

Gene name
piuB
Definition
(GenBank) iron-regulated membrane protein
Organism
cdh  Corynebacterium diphtheriae INCA 402
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PepSY_TM PepSY Wzy_C
Motif
Other DBs
NCBI-ProteinID: AEX45398
Position
88133..89503
Genome map
AA seq 456 aa AA seqDB search
MVATYTPAAEKQEASTRALPRHLRRLHFFAGIICAPLIFIASLTGLGYAFGPSLDKAVYS
EAINVTPSGDELPLERIVDIARATHPDLELAGVRVGNPDQATRVMFNDPTLPKSTTQAVF
VNQYTGDITGDMPQYGGSAALPIRHWLSLGHRDLWLGEPGRLYSETAASWLGVLAVSGVY
LWWKRQRKAGRLAAMLRIDGRGRTRNLRWHGAIGTLVAAGMIFLTITGLTWSSVAGDNIR
SVRTALNWTTPSVSTALGAAAEQTPADPHAEHGGHSGHHAHMAALDVSEQAQRVATTAAG
ELRTPFTVKPPKEDGHAWTAAEDRVAYRLTYDALAVDGSNGQVTDRVDFEQWSLPAKLTA
WLIELHMGTLLGVPNQIALGLLAIGLLILVVRGYLLWFQRRGTAWVGSAPARSVDGVRGY
GALGWIGVAAMVIYGVVAPLFGVTCVAFLICSMLKK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggttgcaacttacacaccggccgccgagaagcaggaagcgtcgacacgcgctttgccc
cgccacctgcgacgactgcacttcttcgcaggcatcatctgcgcgccactcatcttcatc
gcatcgctgaccggcctcggctacgccttcggtcctagccttgataaagctgtctactcc
gaagccatcaacgtcacacccagcggcgatgagctaccgctagaacgaatcgttgacatc
gcccgcgccacccaccccgaccttgaactcgctggtgtgcgcgtaggcaaccccgaccaa
gccacgcgcgtgatgttcaacgaccccaccttgcccaagagcaccacgcaggcagtcttt
gtcaaccaatacaccggcgacatcaccggcgacatgccgcaatacggcggatcggcagca
cttcccatccgacactggctctcactcggacaccgcgatctctggctcggcgaacctggc
cgcctctactccgaaaccgccgcatcgtggctcggtgttctcgccgtcagtggcgtgtac
ctgtggtggaaacggcagcgcaaagctggccgcctagctgccatgttgcgtatcgacggc
cgcggccgcacccggaatctgcgctggcacggcgcaatcggcacccttgtggccgccggc
atgatctttttgaccatcactggcttgacatggtcgtctgtagcaggcgacaatattcgt
tcggtgcgcaccgccttgaactggactacgccgtcggtaagcacggcgctcggtgcggcg
gccgagcaaacccccgccgacccccacgctgagcacggcggacacagcggacaccatgcg
cacatggcagctctggacgtatctgagcaggcacaacgcgtagcaaccaccgctgccggc
gaactgcgcaccccctttaccgtcaagcccccgaaggaagacggccacgcctggaccgcc
gcggaagaccgcgttgcttaccgcctcacctacgacgccttagctgtcgacggctccaac
gggcaggtgaccgaccgtgtggactttgagcagtggtcattgcccgcaaagctcactgcc
tggctgatcgaattgcacatgggcaccctgctgggcgtacctaaccaaatcgccctcggt
ctgttggctattggccttctcatcctcgtggtgcgtggctacctgctgtggttccagcgt
cgtggcaccgcgtgggttggtagcgctccggcgcgcagcgtagacggtgtgcgcggatat
ggcgcacttggctggataggcgttgctgccatggtgatctatggcgtggtggcacccctg
tttggtgttacctgcgtggcgtttttgatctgcagcatgctgaagaagtga

DBGET integrated database retrieval system