KEGG   Corynebacterium diphtheriae INCA 402: CDB402_0087Help
Entry
CDB402_0087       CDS       T01688                                 

Definition
(GenBank) hypothetical protein
  KO
K06966  pyrimidine/purine-5'-nucleotide nucleosidase [EC:3.2.2.10 3.2.2.-]
Organism
cdh  Corynebacterium diphtheriae INCA 402
Pathway
cdh00230  Purine metabolism
cdh00240  Pyrimidine metabolism
Brite
KEGG Orthology (KO) [BR:cdh00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CDB402_0087
   00240 Pyrimidine metabolism
    CDB402_0087
Enzymes [BR:cdh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.10  pyrimidine-5'-nucleotide nucleosidase
     CDB402_0087
    3.2.2.-  
     CDB402_0087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lysine_decarbox Acetyltransf_1 Acetyltransf_7 Acetyltransf_10
Motif
Other DBs
NCBI-ProteinID: AEX45399
Position
89516..90739
Genome map
AA seq 407 aa AA seqDB search
MPKLFEARSISAGRRYKKRCNLARTTHSQSSRQLLHNPRSALDCVHMSFSPELPDFMQGL
GVSVHAMTNADVPAHTDSVLRNLNRFEQHFTADDLAVAPLSEYTFFNEGRGDIGIVVQDA
SGAVVGTMCVQFIKGLAYLNPAVPEMTLRLDEAWRGKGIGGWLIEQATEYGRLNGWPGIA
VNVEKQSPARRLYARHDFAAQDREVEYGAIMLKTLSPKIRSVAVYCGSAVGERPEYAQAA
RELGTALAQRGITMVYGGGRPGLMGIAADAAIAAGGKVHGVMPHALVDLEQAHPSLSALD
ITDTMAQRKTRMEELADAFVVLPGGMGTMEEMSQVLVRQQLGPYAGPVALMNIEEFWDPF
IAALRTMSEEGFISERYIDALVMAKDSEELFQGFSSWVNPGLKWLSD
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
gtgccaaaactttttgaggctcgcagcatttccgcaggtcggagatataagaaaagatgc
aatttggcacgaactactcactcgcaatcatcacggcagttattacacaatcctcgtagt
gccctagactgtgttcacatgagcttttccccagaactgcctgactttatgcagggcctc
ggcgtgtccgtccatgccatgaccaacgccgatgtccccgcgcacacggactccgtttta
cgtaacctgaatcgttttgagcagcactttaccgccgacgatctcgctgtagcgccgttg
tcggagtacaccttttttaacgaggggcgtggcgatattggcatcgtggtacaagatgcc
tctggtgccgtcgtgggtaccatgtgcgtgcagtttattaaaggactggcctacctcaac
cccgctgtgcctgagatgacgcttcgtttggatgaagcgtggcgcgggaaggggatcggt
ggctggttgattgagcaggcaaccgagtatggtcgcttgaacggttggcctggtattgcg
gtgaatgtggaaaagcagtcgccagctcgtcgcctttatgcgcgccatgatttcgctgct
caggaccgtgaggttgaatatggcgctatcatgctgaagaccttgagtccgaagattcgt
agcgttgctgtgtattgcggctcggctgtgggggagcgacctgagtatgcgcaggcggcg
cgtgagttgggtactgcgttggcgcagcgcggtatcaccatggtttatggtggcggcagg
ccaggtctgatgggtattgctgccgacgctgccatcgctgcgggtggcaaggtgcatggt
gtgatgccgcatgcgcttgttgatctagagcaggcgcatcctagtttgagtgcgctcgat
attactgacacgatggcgcagcgtaagacgcgcatggaagagcttgccgacgcctttgtg
gttctgccaggtggtatgggcaccatggaggagatgtcccaggtgttggtgcgtcagcag
ctagggccgtatgcggggccggtggcgttgatgaacattgaggagttctgggatccgttt
attgctgcattgcgcacaatgagtgaagagggctttatttcagagcgttatattgatgcg
ctggtgatggcgaaagattctgaggagcttttccaaggcttcagctcgtgggtgaaccct
gggctgaagtggctgtccgactag

DBGET integrated database retrieval system