KEGG   Corynebacterium diphtheriae INCA 402: CDB402_0091Help
Entry
CDB402_0091       CDS       T01688                                 

Definition
(GenBank) hypothetical protein
Organism
cdh  Corynebacterium diphtheriae INCA 402
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEX45404
Position
complement(93851..94435)
Genome map
AA seq 194 aa AA seqDB search
MGVLSFVRLLRPVSVVRGYTLRSEVTKLVEVSTVRLTTVCQATVTTTAIAAAVALGVCGC
SSAGSVQQAAPETIQPGGYVVALSSNVDLVCDFTPAQAQCSPLQFVTTWKNTEGAHEQAT
TVVVQAEPFAVTATGKQPPVRDQGFAHLGKEHRYVVGDPQSGWTVDTSAPDSIKISRPDG
KGVVITRDSYEVVN
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgggggtgttgtcctttgttcgtcttctgcgccctgtcagcgttgttcgtggttacaca
ctacgctcggaggtaaccaagcttgtggaggtgagcaccgtgagattgactaccgtttgt
caggccactgtaactactactgcgattgctgccgcggtggcattgggggtgtgtggttgt
tcgtcggctgggtcggtccagcaggcagcaccggaaaccattcagcccggtggctatgtg
gtagcccttagcagcaatgtagaccttgtttgtgatttcaccccagcccaagcccagtgt
tcaccgctgcaatttgttaccacgtggaaaaacacggagggtgcccatgagcaggccacc
actgtggtggtgcaagcggagccgtttgcggtcacagcaacgggtaagcagccaccggtg
cgcgatcagggttttgcacacttgggtaaagagcaccgctatgtggtcggcgatccgcag
tctgggtggacggtcgatacctcggcaccggattcgataaaaatcagcaggcctgatggc
aagggcgtggtgatcacccgagattcctatgaggttgtgaattaa

DBGET integrated database retrieval system