KEGG   Corynebacterium diphtheriae INCA 402: CDB402_0097Help
Entry
CDB402_0097       CDS       T01688                                 

Definition
(GenBank) putative oxidoreductase
Organism
cdh  Corynebacterium diphtheriae INCA 402
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: AEX45409
Position
99217..99993
Genome map
AA seq 258 aa AA seqDB search
MIAPVARRHFSWKASAMSNQDVVNEKKIAVVTGASSGIGEAAARALAADGWHVIVAARRK
HLLDVLAADIAGTAIELDVTSDESVAAFATQIPRCDLLVNNAGGALGLDPIAQANLEDWQ
WMYDTNVLGTLRVTRALLDVLSSSNGLIINISSIAGIAPYAGGAGYNAAKFGVSAMDKVM
RIEFQERGIRVAEINPGRVHTDFSLVRFKGDQQAANAVYEGKVNLTAGDIAETIRWVASL
PAHVNIDRLVITPQDQVI
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcccccgtggcgcgtcgccacttctcgtggaaagctagtgccatgtcgaatcaa
gatgtggttaatgagaaaaagattgcggttgttaccggtgcctcctcgggtattggtgag
gctgccgcgcgtgctcttgcggccgatggttggcatgtgatcgtagcggcgcggcgcaaa
cacctgttggatgttttggctgctgatattgccggtacagcgattgaacttgatgtgaca
agcgatgagtccgtggctgcgtttgcgacgcagattccgcgatgtgatctgctggtgaat
aacgcgggaggcgcattagggcttgatcccattgcccaagcaaaccttgaggattggcag
tggatgtatgacaccaacgtgttaggcacattgcgggtaacgagggctctgcttgatgtg
ttgagtagcagtaatggtctgattatcaacatcagttcgatcgccggtatcgcgccctat
gccggtggtgctggctataacgctgcgaagttcggggtatcggccatggataaggtcatg
cgcattgagttccaagaacgaggtatccgtgtggcagaaatcaacccaggtcgggtgcat
actgatttttcgctggtgcggtttaaaggtgaccagcaggcagccaatgccgtctatgag
ggcaaggtgaacctcaccgcgggcgatattgcggaaacgatccggtgggtggcctcgttg
cctgcacacgtcaacattgaccggcttgtgatcaccccacaggatcaggtgatctag

DBGET integrated database retrieval system