KEGG   Corynebacterium diphtheriae INCA 402: CDB402_0099Help
Entry
CDB402_0099       CDS       T01688                                 

Definition
(GenBank) transposase-like protein
Organism
cdh  Corynebacterium diphtheriae INCA 402
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_28 HTH_29 HTH_32 HTH_Tnp_1 HTH_23 Sigma70_r4 Sigma70_r4_2 NRBF2 HTH_38
Motif
Other DBs
NCBI-ProteinID: AEX45411
Position
101228..101689
Genome map
AA seq 153 aa AA seqDB search
MNTRSSLSEEQREQLVGLFEQDLGFTAAARRIGVRRAPVRSLYHRWLLHGRLCLVEKPTK
KHYSFEIKKEVVDRFLAGETRMDLAKEFKLSSPQQVKDWVSTWRKGGDEALRPKPKGRPK
GSARPVLLTEEDRLRREVEKLRAENAYLKNCGT
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgaacacacgaagttctctgtcagaagaacaacgagaacagctcgttggcctatttgag
caagacttgggttttacggctgcggcacgtcggattggggtccgacgcgccccagttcgt
agcctgtaccatcgctggcttctccatggcaggctatgtcttgtggagaaaccaaccaag
aagcactactccttcgagatcaaaaaggaagtagtcgaccgtttccttgctggcgaaaca
cgcatggacctagcgaaggaatttaagctgtcctcacctcaacaggtcaaagactgggtg
agtacgtggcgcaaaggcggtgatgaggcacttaggcccaaaccgaaaggacgaccgaaa
ggctcagctcggcctgtactgttgaccgaggaagacagacttcgccgtgaagtggagaaa
cttcgggcggaaaatgcctacctaaaaaattgcgggacttga

DBGET integrated database retrieval system