KEGG   Corynebacterium diphtheriae INCA 402: CDB402_0101Help
Entry
CDB402_0101       CDS       T01688                                 

Definition
(GenBank) hypothetical protein
Organism
cdh  Corynebacterium diphtheriae INCA 402
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SUKH_6 SMI1_KNR4 SUKH_5
Motif
Other DBs
NCBI-ProteinID: AEX45413
Position
102671..103609
Genome map
AA seq 312 aa AA seqDB search
MNHYDVDFEFPGKKCTVLKIAQIEKTLGKKLPKPYRDLIKCCGGGILSLKNSFINLPLDD
RSEDYELSIDQILGNGKTSSGDNNDLLTYGRFLTEEYEIPDEVLLCAISEAGMHEYLVIN
YGLKDFPEGSVLYCNDEENPGEYIQVASTFAEFLELLEPDPEFSESTVESDPKRIHERSM
NGALTPELERAIAATPTPDLEYKIRCAAERTGLYPAGRSQETWYFFDLVYWAIQHVKPYR
EIGQLTNIDSPESMRIMLRDSFIIPEFRSSGFMSIQDTFELWWEDRVKENRLVQHEDGYR
LDSSYMDTVLKK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaaccattacgatgtagattttgaatttcccggcaaaaaatgcacggttttaaagatt
gcgcaaatcgaaaagacactcgggaaaaagcttccaaagccctatagggatttgatcaag
tgctgtgggggaggaatactttccctcaaaaacagtttcatcaacctgccgttggacgac
agatccgaagactacgaactatctatcgatcaaattctcggcaacgggaaaacctcaagt
ggagacaacaacgatctactcacttatggccgattccttaccgaagaatacgagatccct
gatgaagtgctgctttgcgcaatttccgaagcagggatgcatgaatacctggtgatcaac
tacggattgaaagacttccctgagggcagtgttttgtactgcaacgatgaagaaaatcct
ggagaatacatccaagtagcatcaacatttgcagaatttcttgagctcttagagccagat
ccagaattttccgaatcaaccgtggaaagcgaccctaagcgcatccatgagcgttccatg
aatggtgcattgaccccagaactcgaacgagcaattgcggcgaccccaactccagacctt
gaatataaaattcgctgcgcagcagagcgcacgggtctatatcctgcagggcgatcgcaa
gagacttggtactttttcgacttagtctattgggccatccagcatgtcaagccttaccgc
gaaatcggacagcttacgaacatagattctccagaatccatgagaataatgttaagagac
tctttcataattccagagttcaggtcctccggatttatgagcattcaggatacttttgag
ctctggtgggaagaccgagttaaggaaaaccggcttgtccaacatgaggatggctatcgt
ctcgatagttcctacatggacaccgtcctcaaaaagtag

DBGET integrated database retrieval system