KEGG   Corynebacterium diphtheriae INCA 402: CDB402_0106Help
Entry
CDB402_0106       CDS       T01688                                 

Definition
(GenBank) hypothetical protein
Organism
cdh  Corynebacterium diphtheriae INCA 402
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEX45418
Position
111213..111710
Genome map
AA seq 165 aa AA seqDB search
MKQPTKKKTQKMKIESSCPLPVKPGMTVAQATEACYQSELGADTYVEEFEGWVDIEALEP
GDLGRKIVCCVEDGICITVEMKYMELPITDTFYGVDLNCQPGEGWTTSLERVARALEDKG
LEVVKRDSYVLLPDLFVAIEVGETIGWFDPAYWSREEFLEEAILA
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaccaacgaaaaagaagacacagaaaatgaagattgaaagttcctgtccgttg
ccagtcaagcctggtatgacggttgctcaggctaccgaggcgtgttatcagtctgaattg
ggtgctgatacctatgtggaggagtttgaagggtgggttgatatcgaggctttagagccc
ggtgaccttggccggaagatcgtatgctgcgtcgaggatggtatctgtatcacggttgag
atgaagtacatggaattaccgattacggataccttctacggcgtagaccttaactgccag
cccggtgaaggttggacgactagtcttgagcgggtcgcgcgagcattggaagataagggg
ctcgaagtagtaaaacgggactcctatgttttgcttcccgacctttttgtagcaattgag
gtaggtgaaacaattggatggtttgaccccgcatattggagccgtgaggagttcctggag
gaagccatactcgcttag

DBGET integrated database retrieval system