KEGG   Corynebacterium diphtheriae INCA 402: CDB402_0110Help
Entry
CDB402_0110       CDS       T01688                                 

Definition
(GenBank) hypothetical protein
Organism
cdh  Corynebacterium diphtheriae INCA 402
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEX45422
Position
113901..114263
Genome map
AA seq 120 aa AA seqDB search
MNIPTTINAYAVALADLGHHVYLGIETGQITRNLPIDGLQAFIRANHEYESAEATFLIPG
LVSDEMTALALISALQQSSTGLCHFVVSEGQIQAKASLLVGEFLTAARLQAWWRRSLDEI
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcctacaacaatcaatgcatacgcagttgccctcgcagatcttggccaccac
gtgtatctcggtattgagaccggtcagatcacgagaaacctccccatcgatggactgcag
gcttttatcagagccaatcatgagtatgaatcggcagaggcaacttttctcattcctggt
cttgtttcagatgaaatgaccgcgttggcactgatcagtgccttgcaacaatcttcgaca
ggtctatgccacttcgttgtcagtgaggggcaaatacaggcaaaggcatctctactagtc
ggagaatttttgacagctgcgcggctgcaggcatggtggcgtcgaagccttgacgagata
tag

DBGET integrated database retrieval system