KEGG   Corynebacterium diphtheriae INCA 402: CDB402_0113Help
Entry
CDB402_0113       CDS       T01688                                 

Definition
(GenBank) hypothetical protein
Organism
cdh  Corynebacterium diphtheriae INCA 402
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3800 DUF4420
Motif
Other DBs
NCBI-ProteinID: AEX45425
Position
complement(115970..116653)
Genome map
AA seq 227 aa AA seqDB search
MKEHLHPSLVRLYGGASDDDAFLYLDESYSVPDEYESGSFYILAAVKLSYGDLEGTRKTL
RDISEKDYWHTTDELRTSEGQYRTVEMLKQLDSWGDKHLVSVEISLQSGGALEQARGDCL
RSLVEHIYGSARDNPPAGLIFEKRLRRVDDNRDRRLVRRLRQEGIFPREVGVAWVSPSDE
QLLWAPDITCMAYRRQITHKGRNETGDYFETYLEPHSTIIYAAPQKK
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagcatctacacccatctttggtgaggctgtacggtggtgcgtctgatgatgac
gcctttctttacctcgatgagtcgtactcggtgcctgacgaatacgagagcgggtccttt
tatatcttggcagcagtgaagcttagctatggggatcttgagggaacccgaaagactctt
cgcgatatttcggagaaggattattggcacacaacagatgaactccgcacctctgaaggt
cagtaccgtaccgtcgagatgctgaagcagctcgactcctggggagacaagcaccttgtt
tccgttgaaatttccctgcagtctgggggagcccttgagcaggctaggggagattgctta
aggtctctggtagagcacatctacgggagcgcacgcgataatcctccggcagggctcatc
ttcgaaaagcgattaagacgagttgacgataatcgggatcggcgtctggttaggaggctc
aggcaggagggcatctttcctcgtgaggtaggcgtagcttgggttagcccatccgatgag
cagcttctatgggctccggacataacttgtatggcctaccgacgtcagattacacacaag
ggcagaaacgaaaccggggactacttcgagacctacttagagccgcactctacgattatc
tatgcagctccccagaagaaataa

DBGET integrated database retrieval system