KEGG   Corynebacterium diphtheriae INCA 402: CDB402_0114Help
Entry
CDB402_0114       CDS       T01688                                 

Definition
(GenBank) hypothetical protein
Organism
cdh  Corynebacterium diphtheriae INCA 402
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEX45426
Position
116686..117102
Genome map
AA seq 138 aa AA seqDB search
MIPPETRLLAVGHAQITQHTSRCAGSATARESKALATMGRRDEQKAEQRWKTDPNGDYAQ
GRRSALQAANAKRDARRAALFKGENGHLGGQNPGGADPSSKELADTLGTSVRRIRHTGSG
YVVVRVLWPSLWGGSSAA
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
ttgattcctccagaaactaggttactggccgtaggccacgctcagataactcagcacacc
tctcggtgcgctggaagcgccactgcccgcgaaagcaaggccctagcaactatggggcgc
agggatgaacagaaggccgaacaacgctggaaaacagaccctaacggcgactacgcacaa
ggacgcagaagcgctcttcaagcagctaatgcaaagagagatgcaaggcgagctgctctc
ttcaaaggtgaaaatggccatcttggaggccagaacccagggggtgccgacccctcatcc
aaggagctagcggacaccttgggaacctcagttaggcggattcggcacacgggttccggt
tacgtagtagttcgcgtgctttggccttcactttggggtggctcgtcggctgcttga

DBGET integrated database retrieval system