KEGG   Corynebacterium diphtheriae INCA 402: CDB402_0126Help
Entry
CDB402_0126       CDS       T01688                                 

Gene name
embC
Definition
(GenBank) arabinosyl transferase C
  KO
K11387  arabinosyltransferase C [EC:2.4.2.-]
Organism
cdh  Corynebacterium diphtheriae INCA 402
Brite
KEGG Orthology (KO) [BR:cdh00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cdh01003]
    CDB402_0126 (embC)
Enzymes [BR:cdh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.-  
     CDB402_0126 (embC)
Glycosyltransferases [BR:cdh01003]
 Polysaccharide
  Bacterial polysaccharide
   CDB402_0126 (embC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arabinose_trans Arabino_trans_C Arabino_trans_N
Motif
Other DBs
NCBI-ProteinID: AEX45438
Structure
PDB: 

Position
complement(126064..129489)
Genome map
AA seq 1141 aa AA seqDB search
MTKPMNTNITGMKWAAILSGVIGFVLFIITPLMPVNQVQSSVSWPQNGSLNSVSAPLMSY
TPISFDAKIPVASVDKLRKGQDLILGTLPANSEDAGARGLFVRANDDGLQITSHGELVLD
LSKRELAQLPADATIAISSTEDETTAGIEGDDSTTETVERDVRPIIMGIYTELESNAAAD
LLNAGLNAHVEINSRFTSSPTLAKYASMWLGGLMLLISLISLGMLDRRDGATDIRFLNKG
FFRPRPLDAIVGTILLVWYFIGANTSDDGFILTMARASSASDYMANYYRWFGVPESPFGA
PYYDLLGLMSKVSTASIWMRLPSLISAIVIWLVLSREVLPRLGEKIAQRRVAQWTTAFVF
LSFWLAYNNGLRPEPIIAAGTLLTWLSFEVAIATQRLLPAAIGTMLAAFTLACGPTGLMA
VTAVLAGLSYLIRIVYRRLPYLNTGASKRSIAVSVMAMVAPFMAAGTAVFIAVFGDQTLR
NVLESIHVRGDKGPALSWYNELVRYQVLMMQTVDGSFARRVGVFFTFVAAALVGATILRQ
GKVPGTNKGPVMRLMLVMVGTLFFMMFTPTKWTHHFGVWAGIAAALAGVGAVALSHIALR
SPRARILLTGGILFVFAFALAGPNGWWYTSSYSIPWWDKTIQFHGIEASTVMLLLSLVVM
AAGVLVSFRKDVAEEQAEARGEDPAMVNRPFRKQHFEGLAAAPIAILSIFAVAFSLASLS
KGFIDQYPNYSVGLGNLRSLKGDTCNLANDVLVETNTNESFLTPLTGTLGDSLTNDDVRG
FDPNRISPWAFTPENRPEALGAANSTNDGSDTAAADSDASNTAEGADSDGSAAQADATSD
NQEEAAKKKETHRADQGVNGSHSRLPFNLDYRTVPVLGSWTDGKQEIAEATSSWFKLPET
TDNTPLVVVSAAGSIKHKDVNGIVENGQKIVLEYGRSNTGDSSGKAEKLGELDLLDSGID
STWRNLRIPLSDIPDDADVIRIHAKDTSLDPDEWIAFTPPRVPTMDTLANQFPASTPGLL
DWAVPLQFPCQRTFNHYAGVAEIPEYRISADAKGKLSGMNFQDFAGGGVTGIAETINSSY
ELPSYSKNDWVRDWGSIKVYKLRTNSKGEAPDVATVDTETITRSGLWYPGRMNIDTKVTK
N
NT seq 3426 nt NT seq  +upstreamnt  +downstreamnt
atgactaagcctatgaacactaacatcaccggcatgaagtgggcggcgatcctttccggt
gtgatcggcttcgtcctgttcatcatcaccccactcatgcccgtcaaccaggtgcaatcg
agtgtgtcgtggccacaaaacggctcactcaacagcgtgagcgctccactgatgagctac
acgcccatctctttcgatgcgaagatcccagtggcaagcgtcgataagctgcgcaaaggc
caagacctcatcctaggcacactgcccgccaacagcgaagatgccggtgcccgcggactc
ttcgtgcgcgcaaacgacgacggcctgcaaatcacctcccacggcgaactcgtgctcgac
ctgagcaaacgcgaactcgcccaactgcctgccgacgccaccatcgcgatctcctcaacc
gaggacgaaacaaccgccggcatcgaaggcgacgactccaccaccgaaaccgtggaacgc
gacgttcgtcccatcatcatgggcatctacaccgagctggaaagcaacgccgcagctgac
ctcctcaacgctggacttaacgcccacgtagagatcaactcacgctttacctcctcgcca
accctagccaaatacgcctccatgtggctcggcggcctcatgctgctgatctccctgatc
tccctcggcatgctcgatcgtcgcgacggcgccaccgacatccgcttcctcaacaagggc
ttcttccgcccacggcccctcgacgccatcgtgggcaccatcctgctggtctggtacttc
atcggcgctaacacctccgacgacggcttcatcctcaccatggccagggcctcctcggcc
tccgactacatggccaactactaccgctggttcggtgtgccagaatcccccttcggcgcc
ccctactacgaccttctcggcctcatgtccaaggtgtccaccgcctccatctggatgcgc
ttaccatcactgatctccgccatcgtgatctggctcgtcctctcccgcgaggtactacca
cgccttggcgaaaaaatcgcacagcgccgcgtcgcacaatggaccacagcatttgtgttc
ctctccttctggctggcctacaataacggcctacgccccgaacccatcattgccgctggc
acactactaacttggttgtcgttcgaggtagcaatcgccacccaacgcctcctaccagca
gcaataggcacgatgctggcagcatttaccctcgcctgcggccccaccggcctcatggca
gtcacagcagtcctcgccggactgtcctacctcatccgcatcgtctaccgacgcctgccc
tacctgaacacgggggcgtcgaaacgctccatcgcggtgagcgtaatggccatggtcgca
ccattcatggccgccggcaccgccgtgtttatcgccgtcttcggtgaccaaacactgcgc
aacgtgctggaatccatccacgtgcgcggcgacaaaggcccagccctgagctggtacaac
gaactcgtgcgctaccaagtgctcatgatgcaaacagtcgacggctccttcgcccgccgc
gtcggagtcttcttcacctttgtcgccgcagcactcgtcggtgccaccatcttgcgccaa
ggcaaagtgccaggcaccaacaagggccccgtcatgcgcctcatgctcgtcatggtgggc
actctgttcttcatgatgttcacccccaccaagtggacgcaccacttcggtgtgtgggcc
ggcatcgccgcagcactggctggtgtaggtgccgtagcgctttcgcacatcgcgctacgc
tccccacgcgcccgcattctgctgaccggcggcatcctcttcgtgttcgccttcgccctc
gcaggccccaacggctggtggtacacctcgagctactccatcccttggtgggacaagacc
atccaattccacgggatcgaagcatcaaccgtgatgttgctgctctcactggtcgtcatg
gctgccggtgtgctcgtatccttccgcaaagacgtcgccgaggaacaagcagaagcccgc
ggcgaagaccccgcgatggtcaaccgccccttccgcaagcagcacttcgaaggccttgca
gccgcacccatcgctatcctgagtatcttcgcagtcgcattctccctagcctcattgagc
aagggattcatcgaccaatacccgaactactccgtcggcttaggcaacctccgttcgctc
aagggtgacacctgcaacctcgccaacgatgtcctcgtagaaaccaacaccaacgagtct
ttcctcacgccgctcaccggcacactaggcgactcccttactaacgacgacgtccgcggc
ttcgacccgaaccgcatctcaccgtgggcatttaccccagaaaaccgaccagaagcactc
ggcgcagccaacagcaccaacgacggttctgacactgccgcagctgactccgacgcatcc
aacactgcagagggtgctgactctgatggctctgcagcgcaagctgacgcaacctccgac
aaccaagaagaagctgcgaagaagaaagaaacccaccgcgccgatcaaggcgtgaacggt
tctcattcccgactccccttcaacttggattaccgcaccgtaccggtgttgggctcgtgg
accgatggcaaacaagaaatcgctgaggcaacctccagctggttcaagctgccagaaacc
accgacaacaccccactggttgttgtctccgccgcaggatccatcaagcacaaggatgtc
aacggcattgtggaaaacggccaaaagatcgtgctggaatacggccgcagcaacactggt
gactcctccggcaaggcagaaaaactcggcgagctcgacctgctcgacagtggtatcgac
tccacctggcgcaacctgcgaatcccactgagcgacatccccgatgacgccgacgtgatc
cgcatccatgccaaagacaccagcctcgaccccgacgagtggatcgcctttaccccacca
cgcgtgcccaccatggacaccttggccaaccaattccctgcctccaccccaggcctactg
gactgggcggtaccactgcagttcccgtgccagcgcaccttcaaccactatgcgggtgtg
gcagaaatccctgagtatcgtatttctgcagatgccaagggcaagctaagcggcatgaac
ttccaggacttcgctggcggtggcgtgaccggcattgctgaaacaatcaactccagctac
gagttgccgagctactccaagaatgactgggttcgcgactggggatctatcaaggtgtac
aagctgcgcactaattccaagggcgaagctcccgatgtagccaccgtggacaccgaaacg
atcactcgatctggactgtggtacccgggccggatgaacattgatacgaaggtgactaag
aactag

DBGET integrated database retrieval system