KEGG   Corynebacterium diphtheriae INCA 402: CDB402_0129Help
Entry
CDB402_0129       CDS       T01688                                 

Gene name
dprE
Definition
(GenBank) decaprenylphosphoryl-beta-D-ribose 2-epimerase component
  KO
K16653  decaprenylphospho-beta-D-ribofuranose 2-oxidase [EC:1.1.98.3]
Organism
cdh  Corynebacterium diphtheriae INCA 402
Brite
Enzymes [BR:cdh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.98  With other, known, physiological acceptors
    1.1.98.3  decaprenylphospho-beta-D-ribofuranose 2-dehydrogenase
     CDB402_0129 (dprE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_4 ALO
Motif
Other DBs
NCBI-ProteinID: AEX45441
Position
complement(132458..133924)
Genome map
AA seq 488 aa AA seqDB search
MTTDKGTSSTAASNGASGALYTEAKKLTGWGRTAPTTAEVLSTPDLDVIVDAVRQVAEQN
DSKPAHLKRGVIARGMGRSYGDPAQNSGGLVVDMQALNKIHSIDPESAIVDVDGGVTLDQ
LMKAALPYGLWVPVLPGTRQVTIGGAIGPDIHGKNHHSAGSFGDHVASMELLVADGRILH
LEPEGSADDPTGELFWATVGGMGLTGIIVRARIRMTKTETAYFIADGDLTANLDETIEFH
SDGSEHNYTYSSAWFDAISPEPKLGRAAISRGSLATLAQLEEIAPKLAKDPLKFNAPQLV
TVPDIFPSFTMNKLSMIAIGELWWLKSGTYKNKVQNLTQFYQPLDLIGEWNRGYGSKGFL
QYQFVVPREAVEPFKDIVKDIQKSGHYSALNVFKLFGEGNKAPLSYPMPGWNVCVDFPIK
PGLGAFLDDLDKRVMEFGGRLYLAKESRTSAENFHKMYPGMEGWLKTRNAIDPTGVFASD
MSRRLELH
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgacaagggcacgtccagcaccgcagcttcgaacggtgcctccggagcccta
tacacagaagccaagaaactcacaggttggggccgtaccgcaccaaccaccgccgaggtt
ctgtccaccccagatctcgacgtaatcgttgatgcagtccgccaggtggccgagcagaat
gattccaagccagcgcacctcaagcgcggcgtgatcgctcgtggcatgggccgctcctac
ggtgaccccgcccagaactccggtggcctcgtcgtagacatgcaagccctgaacaagatc
cactccatcgacccagaatcggcaattgtcgacgtcgacggtggcgtgaccttggaccag
ctcatgaaggccgcactgccttatggcctgtgggttcccgttctaccaggtacccgccaa
gtaaccatcggcggcgcaattggccctgacatccacggcaagaaccaccactccgcaggt
tccttcggcgaccacgttgcctccatggaactgctcgttgccgacggccgtatcctgcac
cttgagccagaaggctccgcagacgaccccaccggcgaactgttctgggcaaccgtcggc
ggcatgggcctgaccggcattatcgtgcgcgcacgcatccgcatgaccaagacggaaacc
gcgtacttcattgccgacggcgacctaaccgccaacctcgacgaaaccatcgagttccac
tccgatggctccgagcacaactacacctactcgtctgcatggttcgacgccatctcccct
gagccaaagctcggccgtgccgccatctcccgcggttcgctggccaccttggcacagctg
gaggagatcgcaccgaagctggctaaggatccactgaagttcaatgctccgcagctggtc
actgtgccggatatcttcccaagcttcaccatgaacaagctctcgatgatcgccatcggc
gagctgtggtggctcaagtccggcacctacaagaacaaggtgcaaaacctcacgcagttc
taccagccactagacctcatcggtgagtggaaccgcggctatggttccaagggcttcttg
cagtaccagttcgtggtgccacgcgaggcagtcgagccattcaaggacattgtcaaggac
attcagaagtccggccactactccgcattgaacgtgttcaagctgttcggtgagggcaac
aaggcaccattgtcctacccaatgcctggttggaacgtctgcgttgacttccccatcaaa
cctggtcttggcgctttcttggatgatctggataagcgcgtgatggaattcggtggccgc
ctgtacttggctaaggagtcccgtacctctgcggagaacttccacaagatgtacccaggt
atggaaggctggttgaagacccgcaacgctatcgaccccacgggtgtctttgcgtccgat
atgtcccgccgcctcgagctgcactaa

DBGET integrated database retrieval system