KEGG   Corynebacterium diphtheriae INCA 402: CDB402_0130Help
Entry
CDB402_0130       CDS       T01688                                 

Definition
(GenBank) hypothetical protein
Organism
cdh  Corynebacterium diphtheriae INCA 402
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEX45442
Position
complement(134041..134289)
Genome map
AA seq 82 aa AA seqDB search
MFGFLRKSQPAPQPKEATSDTIATQHTSAPLSNDMMLLMAEEIPMLDSNSRVRVYEILEQ
YDGPTICSQEELPREIREMMDL
NT seq 249 nt NT seq  +upstreamnt  +downstreamnt
atgttcggttttttgcgtaagtcccaacccgcaccacagcccaaagaggccacaagcgac
accatcgcaacgcaacacacctcagcgccattaagcaacgacatgatgctgctcatggca
gaagaaatccccatgctcgacagcaactcgcgagtacgcgtttacgaaatcctcgagcag
tacgacggccccaccatctgctcccaagaggaactaccacgcgaaatccgcgaaatgatg
gatctataa

DBGET integrated database retrieval system