KEGG   Corynebacterium diphtheriae INCA 402: CDB402_0131Help
Entry
CDB402_0131       CDS       T01688                                 

Definition
(GenBank) putative membrane protein
Organism
cdh  Corynebacterium diphtheriae INCA 402
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEX45443
Position
134318..134752
Genome map
AA seq 144 aa AA seqDB search
MSWGFASVCPMTNQARICCLSAALSVGLITALPDYVANKAVRWLLNSLIAGAGVGVVAYV
NKQDEDPTNDLDVVARELIDGSQFGPAATWGLFLAVVALLFVQRIDAKLTAVVTGWLRRR
GVRAPHTVLGVLAAALTYAEVSKS
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgtcatgggggttcgctagtgtgtgtcctatgacgaaccaagcacgtatttgctgtctt
tccgccgcgttgtctgtcggcctgattaccgcgttgccggattatgttgccaacaaggct
gttcgctggctgcttaactcgctgattgcgggcgctggtgttggtgtggtggcgtatgtg
aacaagcaggacgaggaccccacgaacgaccttgacgttgttgcccgcgagcttatcgac
ggctcccagttcggacccgcagccacctgggggctgttcctcgccgttgtggcgctgctg
ttcgtgcagcgtatcgacgccaaactcaccgccgtggtcaccggctggttgcgccgtcgc
ggcgtgcgcgccccacacactgtgctcggtgttcttgctgcggcactgacctatgcggaa
gtatcaaagtcatga

DBGET integrated database retrieval system