KEGG   Corynebacterium diphtheriae INCA 402: CDB402_0135Help
Entry
CDB402_0135       CDS       T01688                                 

Definition
(GenBank) putative glycosyl transferase
  KO
K16649  rhamnopyranosyl-N-acetylglucosaminyl-diphospho-decaprenol beta-1,3/1,4-galactofuranosyltransferase [EC:2.4.1.287]
Organism
cdh  Corynebacterium diphtheriae INCA 402
Pathway
cdh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdh00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cdh01003]
    CDB402_0135
Enzymes [BR:cdh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.287  rhamnopyranosyl-N-acetylglucosaminyl-diphospho-decaprenol beta-1,4/1,5-galactofuranosyltransferase
     CDB402_0135
Glycosyltransferases [BR:cdh01003]
 Polysaccharide
  Bacterial polysaccharide
   CDB402_0135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3
Motif
Other DBs
NCBI-ProteinID: AEX45447
Position
complement(136851..137768)
Genome map
AA seq 305 aa AA seqDB search
MPLSTSDNIAAVIVTHKRVELLRASLEVVAAQTHPVKWIIVVDNGCEDAVRDLLHSVAGD
RGIYLPSHTNLGGAGGFAYGFLTALALGADAIWCADDDGRPEGPQVLATLIDAAVTHQLD
EVSPVVCNVDDPNRLAFPLRRGLEWRRYRSELIDPNNPSDTLLPGIASLFNGALISAAAM
ERIGVPDLRLFIRGDEVEYHRRLVRSGLNFGTCLTTAYLHPDGSDEFKPILGGRMHTQYP
ASDAKRYFTYRNRGYLMNQPGMRRLLPQEYARFAWFFLIQRRDPRGFLEWFKLHQLGRSE
KFERP
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgccgctttccacttcagataacatcgccgcagtcatcgtgacccacaagcgcgtcgaa
ctcctccgcgcctccctcgaggtggtagccgcgcaaacccacccagtgaagtggatcatc
gtggtcgacaacggctgcgaagacgcagtacgcgacctcctccacagcgtcgccggcgac
cgaggcatctacctgccatcgcacaccaacctcggcggcgccggcggattcgcctacgga
ttcctcaccgccctcgccctcggagccgacgccatctggtgcgccgacgatgacggccgc
cccgaagggccccaagtacttgccacgcttatcgacgcagccgtcacccaccaactcgac
gaagtctcccccgtggtctgcaacgtggacgaccccaaccgactcgccttccccctacga
cgcggactcgaatggcgacgctaccgcagcgaactcatcgaccccaacaaccccagcgac
accctcctacctggcatcgcctccctcttcaacggcgccctcatctccgccgcagccatg
gaacgcatcggtgtgcctgacctgcgactattcatccgcggcgacgaagtcgaataccac
cgccgcctcgtacgctccggcctcaactttggcacctgcctcaccaccgcatacctccac
cccgacggctctgacgaattcaaacccatcctcggcggacgcatgcacacccaatacccc
gccagcgacgccaaacgctacttcacctaccgcaaccgcggctacctcatgaaccaaccc
ggcatgcgacgcctcctcccacaggaatacgcccgcttcgcctggttcttcctcatccag
cgacgcgacccccgcggattcctcgaatggttcaaactccaccaactcgggcgctccgag
aaattcgaacgcccctag

DBGET integrated database retrieval system