KEGG   Corynebacterium diphtheriae INCA 402: CDB402_0138Help
Entry
CDB402_0138       CDS       T01688                                 

Gene name
iutC
Definition
(GenBank) ABC-type iron uptake system membrane protein
  KO
K11708  manganese/zinc/iron transport system permease protein
Organism
cdh  Corynebacterium diphtheriae INCA 402
Pathway
cdh02010  ABC transporters
Module
cdh_M00319  Manganese/zinc/iron transport system
Brite
KEGG Orthology (KO) [BR:cdh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CDB402_0138 (iutC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cdh02000]
    CDB402_0138 (iutC)
Transporters [BR:cdh02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Manganese/zinc/iron transporter [MD:M00319] [OT]
    CDB402_0138 (iutC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC-3 FecCD
Motif
Other DBs
NCBI-ProteinID: AEX45450
Position
139737..140636
Genome map
AA seq 299 aa AA seqDB search
MSLIEFLSEFSFRRVVLGTMLIGLCSGAMGTFLYLRRQSMMSDVIGHSATPGVMGSFLLF
STVPVLAGSQLLAQWGIDARSMPVITVGALITGLASALLADKVAATTRIGIDATMAVMLS
LFLGGGLILLQIIQRGRYKGKGGIDELMFGNAATLTNLDVRTLAVVSVVILGVIVALWRP
FTLLVFDPVLARMSGMPRWINGVLFVIITLGMVIGVKAVGLILMIAFAVFPPAAARQWSR
TALQMVVASALIGGASAVLGTYISISVGKVPTGPVIVLVLAVIVLVSMVLSPRRSGVSA
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgattgagtttttgtcggagttttctttccgtcgtgtggtgctgggaaccatg
ttgattggtttgtgttcgggtgccatgggaacgtttttgtatttgcgcaggcagtcgatg
atgagtgatgtgattgggcactctgcgactcctggtgtgatgggttcgtttttgttgttt
tctacggttccggtgttggcggggtcgcagttgctggcgcagtgggggattgatgcgcgt
tcgatgccggtgattacggtgggggcgttgattacggggttggcgtcggcgttgttggcg
gacaaggttgctgcgacgacgcgcattggtattgatgccactatggcggtgatgttgtcg
ctgtttttgggtggcggcctgattttgctgcagatcattcagcgtgggcgttataagggc
aagggcggcattgatgagttgatgtttggtaatgctgccacgcttactaatttggatgtg
cgcacgttggctgtggtgtctgtggtgattttgggtgtgattgtggcgttgtggcggccg
tttacgctgttggtgtttgatccggtgttggcgcggatgtcggggatgccgcggtggatt
aatggtgtgttgtttgtgattatcacgctgggcatggtgattggtgtgaaggcggtgggc
ctgatcttgatgattgcgtttgctgtgttcccgccggctgctgcgcgtcagtggtcgcgt
acggcgttgcagatggtggttgcgtcggctctgattggtggggcgtcggcggtgttgggc
acctatatttcgatttcggtgggtaaggtgcccacgggcccggtgattgtgttggtgctg
gctgtgattgtgctggtgtcgatggtgttgtcgccgcgtaggagtggggtgtcggcatga

DBGET integrated database retrieval system