KEGG   Corynebacterium diphtheriae INCA 402: CDB402_0165Help
Entry
CDB402_0165       CDS       T01688                                 

Definition
(GenBank) hypothetical protein
Organism
cdh  Corynebacterium diphtheriae INCA 402
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIN_3 Clathrin PqqD
Motif
Other DBs
NCBI-ProteinID: AEX45477
Position
170949..171521
Genome map
AA seq 190 aa AA seqDB search
MFAAVLDTCVLWPSLQRDIILTLAAHRFFKPLWSIEILEELEFHETRKLIDHGIPSQAAE
LRAQRLVKKMKMHFPNSVVLGTGSFAIQEELPDPDDAHVLAAAILGNAGAIVTDNIKHFP
NALMPSYITTKSSRDFLADAIGVDPQQAFMAICKMSDRYMNPRYDVEDIIELLEERYKAI
EAAELLRAVL
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgttcgccgcagttctagatacgtgtgtgctctggccatcgttacagcgtgacataatc
ttgacattggctgcccaccgctttttcaaacccctatggagcatcgaaatattagaagaa
ctggaattccatgagacacggaagctcatagatcatggaatccccagccaagctgctgag
ttgcgagcacaacgactagttaaaaagatgaagatgcattttccgaattctgttgtttta
ggaactggttcattcgctatacaagaggaacttcctgatccagacgatgcgcatgtacta
gcagctgcaattttgggcaatgctggagcgattgtcacggacaacattaaacattttccg
aatgcactcatgccgtcgtacataacgactaaatcatctagggattttttagcagacgcg
ataggcgttgatcctcagcaggcgtttatggcgatttgtaaaatgtcggaccgttatatg
aatcctcgatatgacgtcgaagacatcattgagttattagaagaacgatataaagctatc
gaagctgctgagttgctgcgcgcagtgctctaa

DBGET integrated database retrieval system