KEGG   Corynebacterium diphtheriae INCA 402: CDB402_0166Help
Entry
CDB402_0166       CDS       T01688                                 

Gene name
mmpL2
Definition
(GenBank) putative drug exporter of the RND superfamily
  KO
K06994  putative drug exporter of the RND superfamily
Organism
cdh  Corynebacterium diphtheriae INCA 402
Brite
KEGG Orthology (KO) [BR:cdh00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    CDB402_0166 (mmpL2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MMPL
Motif
Other DBs
NCBI-ProteinID: AEX45478
Position
171869..174205
Genome map
AA seq 778 aa AA seqDB search
MAAFLYRVGAWSFRAKWFVIVTWLVVLAAVGGAAAAFQAGFNDLFTINNTPAKTATEIYL
ENFPDQRNPLKSTGVNVVFKAPEGHTLAEPENKAAVDSVVQAIQDNLEGLTNTQRFGNPV
DLNPKLQQGVVDLMTQRGVPEENARADAANLSLLTPDETIGYTTFDIDVPMPADVSDAQR
QAITDAMNLGREKGLTVEAGGAGFGDPIVIEETSEIIGVAIAAIILIFTFGSLVAAGLPL
LIAVIGVGIGSLSITLATAWVSLNNVTPVLAVMLGLAVGIDYSLFIMFRYRRELLHVGKE
QAAGMAVGTAGSAVVFAGLTVIIALVALAVANIPFLTYMGLAAAFTVFIAVLIALTMVPA
LLGALGDKAFAVRLRRKRRTSPARTLGRKWVELVHRAPGVVIAVSVVTLGALTLPALQLH
LSLPSDTQASYSSTQRKQAEIMAEGFGPGINSPFLVVADAHSVDENAEILEPLIRAQNPG
LGERKQAAANAAYQYIIQKYSVTPDVKHVQIVGLSEDGLAAQLLLTPESSPEDDVTKQLI
DALLIKQDEVNNATGIRSGITGLIPVQQDVTNRLAGVMPLYLGIVVGLAVLLLMIVFRSI
WVPVVAGVGFLLSVGAAFGVTVLFWQEGLWGLVDTPSPIIAFMPIFLIGVCFGLAMDYQV
FLVSAMRERFVHGRIDATSRYNAIEESIVEGFASSVRVVTAAALIMIAVFVAFIGQPIPF
IKIFGFALGAGVLFDAFFIRMAFVPAAMFLLGRQTWYMPRWLDKVLPRLDVEGTSLER
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
gtggccgcctttttgtatcgtgttggcgcgtggtcgtttcgggccaagtggtttgtgatt
gtcacgtggcttgttgtgcttgcggctgtgggcggtgctgccgctgcgtttcaagcgggc
tttaatgatctatttacgatcaataacactccggcgaagacggcgacggagatttatctg
gaaaactttcctgaccagcgcaatccgttgaagagtacgggtgtgaatgtggtgtttaag
gcaccggaggggcacacgctggctgagccggagaacaaggctgccgtggatagtgtggtg
caagcgatccaagataatcttgagggcctgactaatacgcagcgttttggcaatccggtg
gatctgaatccgaagttgcagcagggtgttgtcgatttgatgacgcagcgtggtgtgccg
gaggaaaacgcgcgtgccgacgcagccaacttgagcctgcttacccccgatgagacgatc
gggtacaccacttttgacattgatgtgcctatgcctgcggacgtcagcgatgcgcaacgc
caggcgatcaccgatgccatgaacttgggccgcgagaagggcctgacagttgaggcgggt
ggtgctggttttggtgatccgatcgtgattgaagaaacttcagagatcatcggtgtggcc
atcgcggcgatcattttgatcttcacgtttggttccttggtggccgctggactcccactg
ctgatcgcagtgatcggtgtaggtattggttcgctgtcgatcacattggctactgcttgg
gtgtcgctgaataacgtcaccccagtgcttgcagtgatgttgggccttgcggtgggtatc
gactactcactgtttatcatgttccgctaccgccgcgagctgctgcacgtgggtaaggaa
caagccgccggcatggctgtgggtactgcgggatctgcggtggtgttcgcgggccttacg
gtgatcatcgcgctggttgctttggcagtggctaatattccattcctgacttacatgggc
cttgccgcagcatttactgtgttcattgcggtgctaattgcgttgacgatggtgccggca
ctgttgggggcgttgggggataaggcctttgcggtgcggttgcgccggaagcggcggacg
tcgccagcccgtacgttggggcgcaagtgggtggagttggtgcaccgcgcgccgggtgtg
gtgattgcggtgagcgtcgtaacgctgggtgcgttgacgctgcctgcgctgcaactgcac
ttgtcgttgccctcagacacgcaggcgagttatagctctacgcagcgtaaacaggctgag
atcatggcggaggggtttggccctggtattaattcgccatttttggtggtggcggatgcg
cactcagtggatgagaacgcggagattttggagccgctgatccgcgcgcagaacccgggg
ctgggggagcgtaagcaggcggcggcgaatgcggcgtatcagtacattattcagaagtat
tcggttactccggatgtgaagcatgtgcagatcgtgggattgtcggaggacggcttggcg
gcgcagttgttgcttacgccggagtcgtcgccagaagatgatgtgaccaagcagcttatc
gacgctctcctgatcaaacaggacgaggtgaacaacgcgaccggtattcgttccggtatt
acaggcctgatccctgtgcagcaggatgtgaccaaccgtctggcgggcgtgatgccgctg
taccttggcattgtggtgggccttgcggtgttgttgctgatgatcgtgttccgcagcatt
tgggtgccggtggtcgctggcgtgggcttcttgctctctgtgggcgcggcgttcggcgtg
actgtgctgttttggcaagagggcctgtgggggcttgtggatactcccagcccgatcatt
gcgtttatgccgatcttccttattggcgtgtgctttggccttgctatggactatcaggtg
ttcttggtatctgcgatgcgggagcgtttcgtgcatgggcgtatcgacgccaccagccgc
tacaacgccatcgaagaatcgatcgtagagggctttgcctcaagtgttcgtgtggtcaca
gctgccgcgctgatcatgattgcggtgtttgtagccttcattggccagccgatcccgttt
attaaaatcttcggttttgccctgggtgccggagtgcttttcgacgctttcttcatccgt
atggcgttcgttccggcagcaatgttccttcttggacggcaaacatggtacatgccacgt
tggctggataaagtgctgccacgtctcgatgtggagggcacatcgctggagcgttaa

DBGET integrated database retrieval system