KEGG   Corynebacterium diphtheriae INCA 402: CDB402_0170Help
Entry
CDB402_0170       CDS       T01688                                 

Gene name
gntK
Definition
(GenBank) putative gluconokinase
  KO
K00851  gluconokinase [EC:2.7.1.12]
Organism
cdh  Corynebacterium diphtheriae INCA 402
Pathway
cdh00030  Pentose phosphate pathway
cdh01100  Metabolic pathways
cdh01110  Biosynthesis of secondary metabolites
cdh01120  Microbial metabolism in diverse environments
cdh01130  Biosynthesis of antibiotics
cdh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cdh00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CDB402_0170 (gntK)
Enzymes [BR:cdh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.12  gluconokinase
     CDB402_0170 (gntK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 Cytidylate_kin APS_kinase dNK Cytidylate_kin2 AAA_22 AAA_16 AAA_24 AAA_28 AAA_17 DUF2075 ABC_tran AAA_5 RuvB_N
Motif
Other DBs
NCBI-ProteinID: AEX45482
Position
complement(178186..178680)
Genome map
AA seq 164 aa AA seqDB search
MSTAVKVVVMGVSGSGKTTVGTLLAERLGVEYRDGDDLHSQANIEKMASGIPLNDDDRWP
WLAQVGEWLAAQPAGGVIGCSALKRSYRDVLRRECPEVVFVHVHGAREVLLERMNHREGH
FMPASLLDSQFATLQPLENDEVGHVFDVTDSPAQIADAAARWLS
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacggctgtgaaggttgttgtgatgggtgtgtctgggtcgggtaagacgacggtg
ggcacgttgttggctgagcggttgggggtggagtatcgcgatggtgatgatcttcattcg
caggccaatattgagaagatggcgagtggtattccgcttaacgacgacgaccgctggccg
tggttggcgcaggtgggcgaatggttggcggctcagccggctgggggtgtgattggttgt
agtgcgttgaagcgtagctaccgtgatgtgttgcgtcgggaatgccctgaggtggtgttt
gtgcatgtgcatggggcccgcgaggtgttgttggagcgtatgaatcatcgcgaggggcat
tttatgccggcgtcgttgttggattcgcagtttgccacgttgcagcctttggaaaatgac
gaagtcggccacgtttttgatgtgaccgactcccctgctcagattgctgatgccgcagct
aggtggctcagctag

DBGET integrated database retrieval system