KEGG   Corynebacterium diphtheriae INCA 402: CDB402_0652Help
Entry
CDB402_0652       CDS       T01688                                 

Gene name
accD2
Definition
(GenBank) acyl-CoA carboxylase, beta subunit
  KO
K17489  methylmalonyl-CoA carboxyltransferase 12S subunit [EC:2.1.3.1]
Organism
cdh  Corynebacterium diphtheriae INCA 402
Pathway
cdh00640  Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:cdh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CDB402_0652 (accD2)
Enzymes [BR:cdh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.1  methylmalonyl-CoA carboxytransferase
     CDB402_0652 (accD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carboxyl_trans MdcE DUF1844
Motif
Other DBs
NCBI-ProteinID: AEX45959
Position
685868..687424
Genome map
AA seq 518 aa AA seqDB search
MAKELSMAERLEKLAAAKAEVSLGGGQAKIDKQHEKGKLTARERIDALVDDGTFFETGMF
AKHRTTHFGMDKANAPADGVVTGSGAVFGRPVHIASQDFTVMGGSAGETQSNKVAAMMEA
SATTGTPFIFINDSGGARVQEGIDSLSGYGKVFYQNVLLSGLVPQVSIIAGPCAGGAAYS
PALTDFIIQTRKANMFITGPGVIKSVTGEEVTSDALGGADAHMTKAGNIHFIADDDEQAV
LIAQKLLSFLPQNNTEEPPVVDPDPVVEPDPELRDIVPVEGKKGYDVRDIISRVVDRGDF
LEVQAGYATNIVVGFARIVGRTVGIIANQPNVMSGVLDINSSDKGSQFIRFCNAFNIPLV
TFVDVPGFMPGVAQEHGGIIRHGAKMLYAYSAASVPKVTIELRKSYGGAHLAMCSKDLGA
DRVFAWPTAEIAVMGAEGAVNVVFRKEIEAAEDKEAKREELIQLYKDTFSTPFMAASRGL
VDDIIDPAETRLHIANALEVLTNKRVTRPAKKHGLGPV
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagaattgtcgatggccgagcgcctcgaaaagctggcagctgctaaggccgag
gtaagccttggcggtggtcaagccaagattgataagcagcacgaaaagggcaagcttact
gctcgcgagcgtatcgacgcgcttgtcgacgacggcaccttctttgaaactggcatgttt
gctaagcatcgcaccactcactttggtatggacaaggcgaatgccccagcagatggtgtt
gtgactggttccggagctgtgttcggtcgccctgtccacatcgcttctcaagacttcacc
gtcatgggtggttctgcaggtgagacgcagtccaacaaggtcgctgcgatgatggaggct
tcggccaccaccggtacgccgttcatcttcattaatgactccggcggagctcgtgtccag
gagggtatcgactccctgtccggttacggcaaggtgttctaccaaaacgtgctgctatcg
ggtctggtcccacaggtctcgatcatcgctggcccttgtgccggtggtgcagcatactcg
ccagcgctgactgacttcatcatccagacccgcaaggcgaacatgttcattactggtccc
ggtgtgatcaagtccgttactggcgaagaagtcacctctgatgcacttggtggtgcagac
gcacacatgaccaaggccggcaacatccacttcattgctgatgacgacgagcaagccgtc
ctgatcgctcagaagctgctgagcttcctgcctcagaacaacactgaggagccacctgtg
gtggatcctgacccagtagttgagcctgatccagagctgcgtgacattgttcctgtggaa
ggcaagaagggctacgatgtccgcgacatcatcagccgtgttgtcgaccgcggtgacttc
ctcgaggtccaggcaggctacgctacaaacatcgtggtcggttttgcacgtatcgttggc
cgtactgtcggtatcatcgctaaccagccaaacgtgatgtcgggtgtcctagacatcaac
tcttctgacaagggcagccagttcatccgtttctgcaacgctttcaacattccactcgtt
accttcgtggacgttccaggctttatgccaggtgttgctcaagagcacggcggtatcatc
cgccacggtgcaaagatgctttacgcatactccgcagcatcggtaccaaaggtgaccatc
gagctgcgtaagtcctacggtggcgctcacttggcaatgtgctccaaggaccttggtgca
gaccgtgtcttcgcatggccaactgctgagatcgctgtgatgggtgcagaaggtgccgtc
aacgtggtcttccgtaaggaaattgaggctgccgaagacaaggaagcaaagcgcgaagag
cttatccagctgtacaaggatacgttctccacaccatttatggccgcatcccgtggtttg
gtggacgacatcatcgatccagcagagactcgcctgcacatcgccaatgcacttgaggtt
ctgaccaacaagcgcgttacccgccctgctaagaagcacggcttgggaccagtgtaa

DBGET integrated database retrieval system