KEGG   Corynebacterium diphtheriae INCA 402: CDB402_1212Help
Entry
CDB402_1212       CDS       T01688                                 

Gene name
tpi
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cdh  Corynebacterium diphtheriae INCA 402
Pathway
cdh00010  Glycolysis / Gluconeogenesis
cdh00051  Fructose and mannose metabolism
cdh00562  Inositol phosphate metabolism
cdh01100  Metabolic pathways
cdh01110  Biosynthesis of secondary metabolites
cdh01120  Microbial metabolism in diverse environments
cdh01130  Biosynthesis of antibiotics
cdh01200  Carbon metabolism
cdh01230  Biosynthesis of amino acids
Module
cdh_M00002  Glycolysis, core module involving three-carbon compounds
cdh_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cdh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDB402_1212 (tpi)
   00051 Fructose and mannose metabolism
    CDB402_1212 (tpi)
   00562 Inositol phosphate metabolism
    CDB402_1212 (tpi)
Enzymes [BR:cdh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CDB402_1212 (tpi)
Exosome [BR:cdh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CDB402_1212 (tpi)
  Exosomal proteins of bladder cancer cells
   CDB402_1212 (tpi)
  Exosomal proteins of melanoma cells
   CDB402_1212 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM BCSC_C
Motif
Other DBs
NCBI-ProteinID: AEX46514
Position
complement(1316858..1317640)
Genome map
AA seq 260 aa AA seqDB search
MARTPLIAGNWKMNLDHLQAVATVQKLAFALPKEYYEKVDVAVTVPFTDLRSVQTLIEGD
KLAITYGAQDVSQHEAGAYTGEISAQMLAKLGCTWVVVGHSERREYHGESSELVAVKAKA
ALNQGISPIVCVGEPLEIREAGTHVEYVVEQTRASLAGLTADDLAKTVIAYEPVWAIGTG
KVASAADAQEVCAAIRNLIIELAGKEVAEGLRILYGGSVKAETVAEIVGQPDVDGGLVGG
ASLDGEAFAKLAANAATVVD
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtactccacttatcgcaggaaactggaagatgaatcttgatcatcttcaagct
gttgcaactgtgcaaaaacttgcttttgcacttccaaaggaatactacgaaaaagtcgac
gtagctgtcaccgtaccttttactgatcttcgctctgttcaaacacttatcgaaggcgat
aagctcgctataacttatggtgctcaagatgtttcgcagcacgaggctggtgcctacacc
ggtgaaatctctgcccagatgcttgccaaactcggatgtacttgggttgttgttgggcac
tcagagcgtcgtgagtaccatggcgaatcttcggagcttgttgcagtcaaagctaaagct
gcgttgaaccaaggaattagccccatcgtttgtgttggagagccccttgaaattcgtgaa
gctggaacacacgtagaatatgtcgtcgaacagactcgcgcatcgttggcgggtcttact
gcagatgatttggcaaagactgttatcgcctacgaacccgtatgggctattggtacgggt
aaagtagcatccgctgccgatgcacaggaagtctgcgcagcaattcgtaacctcatcatt
gagcttgctggtaaagaagtagctgaagggcttcgcattctttatggcggatcagttaaa
gcagaaacagtagccgagatcgtaggtcaaccggatgttgatggcggcttagtgggtggc
gcttctcttgacggtgaagcattcgccaaactagcagctaatgcagcaactgttgtcgac
tag

DBGET integrated database retrieval system