KEGG   Corynebacterium diphtheriae INCA 402: CDB402_1293Help
Entry
CDB402_1293       CDS       T01688                                 

Definition
(GenBank) putative aminotransferase biotin synthesis related protein
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
cdh  Corynebacterium diphtheriae INCA 402
Pathway
cdh00780  Biotin metabolism
cdh01100  Metabolic pathways
Module
cdh_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
cdh_M00577  Biotin biosynthesis, BioW pathway, pimelate => pimeloyl-CoA => biotin
Brite
KEGG Orthology (KO) [BR:cdh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CDB402_1293
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cdh01007]
    CDB402_1293
Enzymes [BR:cdh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     CDB402_1293
Amino acid related enzymes [BR:cdh01007]
 Aminotransferase (transaminase)
  Class II
   CDB402_1293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 Beta_elim_lyase DegT_DnrJ_EryC1 Cys_Met_Meta_PP SHMT
Motif
Other DBs
NCBI-ProteinID: AEX46595
Position
1408604..1409803
Genome map
AA seq 399 aa AA seqDB search
MSPSLDFYAHQRNVEWRERGLERTTAQFSSPQTPHAIIDNRPTLLFSSSDYLGLSEHPFL
KNAAIQAISSLGTGSGGSRLTTGSSIHRSIEIHLAQFFGSPDAVFFASGYQANVTIISTL
AGKDCTIYSDSLNHASIIDGCRLSKSQVKTFPTGDYEALDDALAHCDTANSLVITDAVFS
MSGTIADLEQLRQVAARHGSWLLIDDAHGIGCLGNAGRGTAHLFPHAPTDFSQEVIVGTS
SKALGGEGGFALCSEQVATLLRNQGRGYVFSTAPSPATMATTDAALTVLEQEPDRVRRLQ
SNIAYFAQQSSHVVPVQKNGFFSAIISYPIGDENQALLSARLLRDKGFFIPAIRYPTVSR
GNAMLRITMTSMHSHQDIDQLADALKQLDSHRFHEIKNT
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtctccatcgcttgatttttatgctcaccaacgcaatgtggagtggcgtgaacgaggc
cttgagcgcacaaccgcgcagttttcttcacctcaaactccacacgcaataatcgataat
cgtcctacgctgctattttccagctctgattatttaggccttagcgaacatcctttccta
aaaaacgccgcaatccaagcaatcagctctttaggtacaggatccggtggctcccgattg
accactggcagcagcattcaccgcagcatcgaaattcatctcgctcaatttttcggctcc
cccgacgcagtgtttttcgcttccggttatcaagcaaatgtcaccattatctccacgctt
gccggaaaagattgcaccatctattcagattcactcaatcacgcctccatcattgatggt
tgtcgactcagcaaatctcaagtaaagacttttcccaccggagattatgaagccctcgat
gacgcattagctcattgtgatactgcgaattcacttgttattaccgacgcagtattttcc
atgtctggcacaatcgcagatctcgaacagttacgccaagtagcagcccgacacggttca
tggttgcttatcgacgacgcccacggaatcggttgcttaggaaacgcagggcgtggcact
gcgcatttgttcccccacgcaccgaccgatttctcacaagaagtaatcgtcggtacgtca
agtaaagcccttggaggcgaaggcggcttcgctttatgctctgaacaggtagccacctta
ttgcgcaatcaagggcgcggatatgtcttttccactgctccttcaccagcaacgatggca
actaccgatgcggcactgacagttctagaacaagaaccagatcgtgtccgcaggcttcaa
tccaatattgcttacttcgcacagcaaagctcacatgtagtcccagttcagaaaaacggg
tttttctccgcaatcatttcatacccaattggagacgaaaatcaggcactgctttctgca
cgactgcttcgtgataagggattttttattccagcaatcagatatccaacagtaagtcgt
ggcaatgccatgttgaggataaccatgacatcgatgcattctcaccaagatattgatcaa
cttgctgatgcactcaagcaattagatagtcatcgtttccatgaaataaagaacacttag

DBGET integrated database retrieval system