KEGG   Corynebacterium diphtheriae INCA 402: CDB402_1404Help
Entry
CDB402_1404       CDS       T01688                                 

Gene name
cobQ
Definition
(GenBank) cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
cdh  Corynebacterium diphtheriae INCA 402
Pathway
cdh00860  Porphyrin and chlorophyll metabolism
cdh01100  Metabolic pathways
Module
cdh_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:cdh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CDB402_1404 (cobQ)
Enzymes [BR:cdh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     CDB402_1404 (cobQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 GATase DJ-1_PfpI SNO GATase_5 MobB Peptidase_S51
Motif
Other DBs
NCBI-ProteinID: AEX46703
Position
complement(1526433..1527872)
Genome map
AA seq 479 aa AA seqDB search
MKSFLVAGCTSDAGKSVVVAGLCRALTRRGLRVAPFKAQNMSNNSAVTPDGGEIGRAQAL
QAYACGLTPSVDFNPILLKPGSDRTSQLVVRGIAIGNVSARSYIEHRTELRKIASESLNS
LRERFDVVVCEGAGSPAETNLRATDVANFGLAEECDLPVYIVGDIDRGGVLAHFYGTHQI
VDDADRARIKGFVVNKFRGDVSILEPGLQDLEDRLGVPTVAVLPFIHGLWIDAEDSLQST
IGATVGPAAAPLGTQRLRVAAIRLPRVSNATDVEALACEPGVTVTWTVDPDSVAEADLVV
IPGSKATLSDLAWLRSTGVADAVMERARSQRPILGICGGFQMMCSHIDDPVESGSTTPVE
GLGIFDVDIKFHPEKTLIRHENGGYEVHHGRVERSTEQPWIGSEGARTQSNFGTHRHGYL
EDDEARRDFLGTVSTLAQRPGFVVAPATSFEAERNKQLDVIADAIEQHWDLDQLIASIT
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcgttcctcgtcgctggatgtacgtcggatgctggtaaatctgttgttgttgca
gggctatgtcgtgcgttgacgaggagaggtttgcgtgtcgccccctttaaagcgcaaaac
atgtcgaataattcggcagttactcctgacggaggggagatcggcagggctcaagcattg
caagcatatgcgtgcgggcttacccccagcgttgatttcaacccgatcttgctaaaacca
ggatcagatcgaacgtcacagctcgttgttcgaggtattgccataggtaatgtatccgct
cgcagctatatcgagcaccgcactgagcttcgaaaaattgcttccgaatcgcttaactcg
cttcgtgagcgtttcgacgtcgttgtgtgtgaaggtgcaggttctcctgctgaaactaac
ctgagggcgacagatgtcgctaattttgggctggcggaggaatgcgatctgcctgtgtat
attgtgggtgatattgatcgtggtggggtactggcacatttttatggaactcatcaaatt
gttgatgatgcagaccgcgctcgcatcaaggggtttgttgtcaataaattccgtggcgat
gtgtcgattcttgaacctggcctgcaagacctagaagatcgtctcggagttcctacagtg
gccgtacttccgtttatccatggtttgtggattgatgctgaagattctttacagtccaca
atcggtgcaaccgttggcccagcagctgcgccactgggtacacaacgattgcgcgtcgct
gctattcggctacctcgcgtttccaacgctacagatgttgaagccctagcttgtgagccc
ggagtcactgtaacgtggacagttgatccggattcggtcgcagaagccgatttagtggtc
atccctgggtctaaggcaacccttagcgatttagcctggctgcgttctacaggtgtcgct
gacgcagtaatggaacgtgcacggtcacagcgaccaattttaggtatttgtggcggcttt
caaatgatgtgttcacacattgacgatccagtggaatcgggaagtactacgcccgtggaa
ggcttggggatttttgacgttgatattaagttccatcctgaaaagacactgattcgtcac
gaaaacggtggatatgaagtccaccatggtcgtgttgaacgaagcaccgagcagccatgg
attggtagcgaaggtgcacgaacgcaaagcaactttggtactcatcgacatggatatttg
gaagatgacgaagcgcgacgtgatttccttggcacagtgtctacactcgcacaacgccca
ggctttgtagtcgctcccgcaacttcttttgaagcggaacgcaacaagcagctcgacgtg
atagccgatgccatcgaacaacattgggatcttgatcaactcattgcatcgattacctaa

DBGET integrated database retrieval system