KEGG   Corynebacterium diphtheriae INCA 402: CDB402_1542Help
Entry
CDB402_1542       CDS       T01688                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cdh  Corynebacterium diphtheriae INCA 402
Pathway
cdh00020  Citrate cycle (TCA cycle)
cdh00310  Lysine degradation
cdh01100  Metabolic pathways
cdh01110  Biosynthesis of secondary metabolites
cdh01120  Microbial metabolism in diverse environments
cdh01130  Biosynthesis of antibiotics
cdh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cdh00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CDB402_1542 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    CDB402_1542 (sucB)
Enzymes [BR:cdh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CDB402_1542 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: AEX46839
Position
1681188..1682786
Genome map
AA seq 532 aa AA seqDB search
MAHSVVMPELGESVTEGTITQWLKSVGDTVTADEPLLEVSTDKVDTEVPSPVSGVLLEIK
FEEDDTVDVGDVIAIIGEEGDAPAAKEEPAEEPKAETPKAEAADSTDVVMPELGESVTEG
TITQWLKSVGDTVDVDEPLLEVSTDKVDTEVPSPVAGTILEILFNEDDTVDVGDVIVRVG
TPGSAPAAKEEPAEAPKEEPKAEAPKAEPKKEAPAKTINNENVPYVTPLVRKLADKHGVD
LTTVEGTGIGGRIRKQDVLAAAGVGAAPAAQVAPAQPVSAASTKSVDPEKQKLIGTTQKV
NRIREITARKTVEALQISAQLTQLHEVDMTKVAELRKANKPAFQEKHGVNLTYLPFFAKA
IVEALVAHPNVNASYNAETKEMTYHADVNLSIAVDTPAGLLTPVIHKAQELSLPELAKAI
VDLADRARNNKLKPNDLSGGTFTITNIGSEGALSDTPILVPPQAGILGTGAIVKRPVVIT
EDGIDSIAIRQMVYLPLSYDHQIVDGADAGRFLTTIKDRLETANFEGDLELS
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggcgcactccgttgtaatgcctgaactgggcgaatccgtcaccgaaggtaccatcacc
cagtggctgaagtccgttggtgacacggtcactgccgacgagccgttgctcgaggtatct
actgacaaggtcgacactgaagttccttcgcctgtctccggtgtcttgcttgagatcaag
tttgaggaagatgacaccgtagacgtcggagacgttattgcgattattggcgaagaaggc
gacgctccagctgccaaggaagagccagcagaggagccaaaagccgagacaccaaaggct
gaagcagctgactccaccgacgtagtcatgcctgaactcggcgagtccgtcaccgaaggc
accatcacccagtggctgaagtccgttggcgacaccgtcgacgttgacgaaccactcctc
gaagtctccaccgacaaggtcgacaccgaagtcccatccccagtcgctggcaccatcctc
gaaatcctcttcaacgaagacgacaccgtcgacgtcggagacgtaatcgttcgcgttggc
accccaggatctgctccagctgccaaggaagagccagccgaggcaccaaaggaagagcca
aaagctgaggcaccaaaggctgagccaaagaaggaagctcctgccaagaccatcaacaac
gagaacgtcccttacgtcactccgctggtccgcaagctggctgacaagcacggcgttgat
ctgaccactgttgaaggcactggtattggtggacgcatccgcaaacaggatgttttggct
gctgctggcgttggcgcagcccctgcagcacaggttgctcctgcccagccagtttctgca
gcatccaccaagtccgtggatccagagaagcagaagctgatcggtacaactcagaaggtc
aaccgtatccgagagatcaccgcgcgcaagactgtggaggctttgcagatttctgctcag
ctcacccagctgcatgaggtcgatatgactaaggttgcggaactgcgtaaggccaacaag
ccagccttccaagaaaagcacggtgtgaacctcacctacttgccattctttgcaaaggca
attgttgaggctttggttgctcacccgaacgtcaatgcgtcctacaacgctgagacaaag
gagatgacctaccacgctgatgtcaacctctccatcgccgttgacaccccagctggtctg
cttacccctgtaatccacaaggctcaagagttgtccttgcctgagctcgctaaggcaatt
gtcgatttggctgaccgtgctcgtaacaacaagctcaagccgaatgatctttccggtggc
accttcaccattaccaacattggttctgagggcgctctcagcgataccccaatcttggtt
ccaccacaggcaggtatcttgggcaccggcgctattgttaagcgtccagtagtcatcacg
gaagacggcatcgattcgattgctattcgccagatggtctacttgccacttagctacgat
caccagatcgtcgatggtgccgatgcaggtcgtttcttgaccaccatcaaggatcgcctt
gagactgcaaacttcgaaggcgacctcgaactctcctag

DBGET integrated database retrieval system