KEGG   Corynebacterium diphtheriae INCA 402: CDB402_1555Help
Entry
CDB402_1555       CDS       T01688                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cdh  Corynebacterium diphtheriae INCA 402
Pathway
cdh00260  Glycine, serine and threonine metabolism
cdh00750  Vitamin B6 metabolism
cdh01100  Metabolic pathways
cdh01110  Biosynthesis of secondary metabolites
cdh01120  Microbial metabolism in diverse environments
cdh01230  Biosynthesis of amino acids
Module
cdh_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cdh00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CDB402_1555 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CDB402_1555 (thrC)
Enzymes [BR:cdh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CDB402_1555 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP PLCC
Motif
Other DBs
NCBI-ProteinID: AEX46852
Position
complement(1693642..1695090)
Genome map
AA seq 482 aa AA seqDB search
MKYISTRDASSTPARFTDILLGGLAPDGGLYLPEQYPQLTEELLEQWRRLLEDKGYAALA
AEVLKLFIDDIPAADIEKITARAYTTPKFSDEDIVPVTKLEHNIYIGHLSEGPTAAFKDM
AMQLLGELFEYELGRRGESLNILGATSGDTGSSAEYAMRGRKGIRVFMLTPAGRMTPFQQ
AQMFGLDDPNIFNIALDGVFDDCQDIVKAVSGDSEFKKNYRIGAVNSINWARLVAQVVYY
ISSWLRVTDSNDQKVSFCVPTGNFGDICAGHIAKQMGLPIDRLIVATNENDVLDEFFRTG
DYRVRSSADTYETSSPSMDISRASNFERFVFDLLGRDAGRVADLFGTQVKQGGFSLAQDP
AFAEAANRYGFASGKSTHADRVATIADCYENRGMMIDPHTADGVKVARDWAVDIDSPIVC
LETALPVKFADTICEATGREPEMPERFANIMDAQRRVTDLPNDVAVVKDFIVTSIEETEK
TQ
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatatttcaacgcgcgacgcatcatcgactccggctcgatttaccgatatcttg
cttggtggacttgcccccgatggcggcctttacctgccggaacagtatccacaactgacc
gaagagctgcttgagcagtggcgtaggttgttagaagacaaagggtatgcggcactcgct
gctgaagtattaaagctatttatcgacgacatcccagccgccgatattgaaaaaataacc
gcccgtgcgtacaccacgcccaagttttctgatgaagacatcgttccagtgacaaaactg
gagcacaacatttatatcggtcatctttcagaaggcccaacggcggcatttaaagacatg
gctatgcagttgctcggcgaacttttcgaatatgagctaggtcgtcgcggcgaatccctg
aatatccttggtgcaacctccggtgacaccggatcgtctgcggaatacgccatgcgtgga
cgtaaggggatccgcgtttttatgctcacccctgcgggacgcatgaccccattccagcag
gcacagatgttcggtcttgatgacccaaatatcttcaatatcgcgctcgatggtgtattc
gacgattgccaagatatagttaaagcagtgtcgggggattcggaatttaaaaagaactac
cgaatcggagcggtgaactccattaactgggcacgtcttgtggcacaagttgtgtattac
atttcttcttggcttcgcgttaccgatagcaacgaccaaaaagtgagcttttgtgtacca
accggcaacttcggtgacatctgcgcagggcatattgcaaaacagatgggtcttcctatc
gatcgccttatcgttgcaacgaatgaaaatgatgtgctcgatgagtttttccgcaccggc
gattaccgtgtacgcagctccgcagatacgtatgaaacgtcctctccgtccatggacatt
tcgcgcgcttctaactttgaacgctttgtatttgatcttctcggacgagatgcaggcaga
gtagctgatctatttggtacccaagtcaagcagggtggattcagcttggctcaggaccca
gcattcgccgaggccgcgaatcgttacggatttgcctccggtaaatctacccatgctgat
cgtgttgccacgattgcagactgctacgaaaatcgtggcatgatgatcgaccctcatacc
gcggacggtgtgaaagtagcacgagattgggctgtcgacattgattcgccaattgtctgc
cttgaaactgcgcttccagttaagttcgctgacactatctgcgaggcaacagggcgcgaa
cctgagatgccagagcgctttgccaacatcatggatgctcaacgtcgtgtaactgatctt
cctaatgacgtagcagtggtcaaagacttcattgtgactagcatcgaggaaaccgaaaaa
actcagtag

DBGET integrated database retrieval system