KEGG   Corynebacterium diphtheriae INCA 402: CDB402_1833Help
Entry
CDB402_1833       CDS       T01688                                 

Gene name
deoA
Definition
(GenBank) Thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
cdh  Corynebacterium diphtheriae INCA 402
Pathway
cdh00240  Pyrimidine metabolism
cdh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdh00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CDB402_1833 (deoA)
Enzymes [BR:cdh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     CDB402_1833 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N TMP_2
Motif
Other DBs
NCBI-ProteinID: AEX47130
Position
complement(2000181..2001464)
Genome map
AA seq 427 aa AA seqDB search
MAEQFDAVDIIRTKRDGGELTTEQINWVIDAYTRGAIGDEQMAALNMAIFIRDMNRREIV
DWTKAMINSGETMDFSALGKKTTDKHSTGGVGDKLSLPLGPLVASYGLAVPMLSGRGLGH
TGGTLDKLEAIPGFEVDIDNDRMMNILKDAGVVIASAGSGLAPADKKIYALRDITSTVDC
VPLIASSIMSKKIAAGADSLILDVKVGSGAFMKDLDHARELARTMVDLGNDAGVHTRALL
TDMSTPLGKKIGNSLEIEETVEVLAGGGPEDVVKLTCELARNMLEMAGIHDADVEERLKD
GRAMDVWKRMVRAQGGDPEAPMARAEHTHEVVADRDGYLMELDALALGVGSWRLGAGRAR
KEDPVQLTAGIEIHADLGQKVVKGQKLLTLHTETPDKFDRALESIIPGIVIGDEQPAERQ
IILDRIV
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggccgaacaattcgacgccgtggacatcattcggaccaagcgcgatggtggcgaactc
accaccgaacaaatcaactgggtgatcgacgcctacacccgcggagccatcggcgacgag
caaatggcagcactcaacatggccatcttcatccgcgacatgaaccgccgcgagatcgtc
gactggaccaaagccatgatcaactccggcgaaaccatggacttcagcgcccttggcaaa
aagaccaccgacaagcactccaccggtggcgtgggcgacaaactctccctgccgctcggc
ccactcgtggcaagctacgggctcgcagtgcctatgctctccggccgcggactcggccac
accggcggcaccctagacaagctcgaagcaatcccaggcttcgaggtagacatcgacaac
gaccgcatgatgaacatcctcaaagatgccggcgttgttatcgcctccgcaggatccgga
cttgcacccgcagataagaagatctacgcgctgcgcgacatcacctccaccgtcgactgc
gtcccactgatcgcaagctccatcatgagcaagaagatcgccgccggtgccgactccctc
atcttggacgtcaaggtcggaagcggtgcctttatgaaggacctcgaccacgcccgcgaa
ctcgcccgcaccatggtcgacctcggtaacgatgcaggcgttcacacccgcgccctgctc
accgacatgtccacaccactgggcaagaagatcggtaactccctcgaaatcgaggaaacc
gtcgaggttctcgccggcggcggcccagaagacgtggtcaagctcacctgcgaactggcc
cgcaacatgctcgaaatggccggaatccacgacgcagacgttgaagaacgcctcaaggac
ggacgcgccatggacgtgtggaagcgcatggtccgcgcacaaggcggcgacccagaagcc
ccaatggcacgcgcagagcacacccacgaagttgtcgccgatcgcgacggctacctcatg
gaactcgacgccctcgcactcggcgttggtagctggcgactcggtgccggacgcgcacgc
aaagaagacccagtgcagctcaccgccggcatcgaaatccacgccgatctgggccaaaag
gttgtcaagggacaaaaactgctcaccctgcacaccgaaaccccagacaagttcgaccgt
gccctcgaatccatcattcctggcatcgtgatcggtgacgaacaaccagccgaacgccag
atcatcctcgaccgaatcgtctaa

DBGET integrated database retrieval system