KEGG   Corynebacterium diphtheriae INCA 402: CDB402_1966Help
Entry
CDB402_1966       CDS       T01688                                 

Gene name
adhA
Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cdh  Corynebacterium diphtheriae INCA 402
Pathway
cdh00010  Glycolysis / Gluconeogenesis
cdh00071  Fatty acid degradation
cdh00350  Tyrosine metabolism
cdh00625  Chloroalkane and chloroalkene degradation
cdh00626  Naphthalene degradation
cdh01100  Metabolic pathways
cdh01110  Biosynthesis of secondary metabolites
cdh01120  Microbial metabolism in diverse environments
cdh01130  Biosynthesis of antibiotics
cdh01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cdh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDB402_1966 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    CDB402_1966 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    CDB402_1966 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CDB402_1966 (adhA)
   00626 Naphthalene degradation
    CDB402_1966 (adhA)
Enzymes [BR:cdh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CDB402_1966 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C adh_short TrkA_N ThiF
Motif
Other DBs
NCBI-ProteinID: AEX47262
Position
complement(2120818..2121858)
Genome map
AA seq 346 aa AA seqDB search
MSATEFPSAFTAAVVDKFGSELNIHDVDLPEPGQHQALVKVLTSGICHTDLHAAEGDWPV
KPKPPFVPGHEGVGEVVKLGPGEHSVALGDMVGNVWLWSACGECEYCRTGWETMCEKAEY
GGYTVDGSFGQYMLVDTRYCARIPDGCDLLEVAPILCAGVTVYKGLKVTETRPGQFVVIS
GVGGLGHIAVQYAVAMGMRVIAVDIADDKLELAKKHGAEFVVNAREEDPTEAIVKYTKGG
AHGVLVTAVHPQAFGQAIGMARKNGTIVFNGLPPGEFPAPIFDIVFKGLTIRGSLVGTRQ
DLEEALDFYARGMIKPTVTECKLDDVNSVFADMKQGKIDGRMAIRY
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctactgaattcccctctgccttcactgccgctgttgtggacaagtttggctcc
gagctcaatatccacgacgttgacctcccagagccaggtcaacaccaagcactggtcaag
gtgctcacctccggcatctgccacactgacctccacgccgccgaaggcgactggccagtc
aagccaaagccaccattcgtcccaggccatgagggcgtaggcgaagtggtcaaacttggc
ccaggtgagcatagtgttgcgctgggtgacatggtcggtaacgtctggctctggtcagcc
tgtggcgagtgcgagtactgccgcaccggctgggagactatgtgcgagaaagccgagtac
ggcggatacaccgtcgatggctctttcggtcagtacatgctggtagacacccgttactgt
gcccgaatcccagacggctgtgacttgctggaagtcgccccaattctgtgcgctggcgtg
accgtgtacaaaggcctcaaggttaccgaaacccgcccaggccagttcgtggtcatctct
ggcgtgggtggtctggggcatatcgccgttcagtacgccgtggctatgggcatgcgcgtt
atcgccgtggatattgcggacgacaagctcgaactggctaagaagcatggcgctgagttt
gtggtcaatgctcgtgaagaagacccaactgaggcaattgtgaagtacaccaagggtggc
gcacatggcgtgctggtcaccgcggtgcaccctcaggccttcggtcaggcaattggcatg
gctcgtaagaacggaaccattgtgttcaatggtcttcctccaggagagttcccggcaccg
atcttcgacatcgtgttcaagggcctgaccatccgcggctccctcgtgggaacgcgccaa
gacctcgaagaggctttggacttctacgctcgcggcatgatcaagccaacggttactgaa
tgcaagcttgacgacgtcaactcggtctttgctgatatgaagcaaggcaagatcgacggc
cgcatggctatccgctactag

DBGET integrated database retrieval system