KEGG   Corynebacterium diphtheriae INCA 402: CDB402_1986Help
Entry
CDB402_1986       CDS       T01688                                 

Gene name
fadA
Definition
(GenBank) acetyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cdh  Corynebacterium diphtheriae INCA 402
Pathway
cdh00071  Fatty acid degradation
cdh00280  Valine, leucine and isoleucine degradation
cdh00310  Lysine degradation
cdh00362  Benzoate degradation
cdh00380  Tryptophan metabolism
cdh00620  Pyruvate metabolism
cdh00630  Glyoxylate and dicarboxylate metabolism
cdh00640  Propanoate metabolism
cdh00650  Butanoate metabolism
cdh00900  Terpenoid backbone biosynthesis
cdh01100  Metabolic pathways
cdh01110  Biosynthesis of secondary metabolites
cdh01120  Microbial metabolism in diverse environments
cdh01130  Biosynthesis of antibiotics
cdh01200  Carbon metabolism
cdh01212  Fatty acid metabolism
cdh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cdh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CDB402_1986 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    CDB402_1986 (fadA)
   00640 Propanoate metabolism
    CDB402_1986 (fadA)
   00650 Butanoate metabolism
    CDB402_1986 (fadA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CDB402_1986 (fadA)
   00072 Synthesis and degradation of ketone bodies
    CDB402_1986 (fadA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CDB402_1986 (fadA)
   00310 Lysine degradation
    CDB402_1986 (fadA)
   00380 Tryptophan metabolism
    CDB402_1986 (fadA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CDB402_1986 (fadA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CDB402_1986 (fadA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CDB402_1986 (fadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cdh04147]
    CDB402_1986 (fadA)
Enzymes [BR:cdh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CDB402_1986 (fadA)
Exosome [BR:cdh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CDB402_1986 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C ECH_1 ECH_2 Dodecin ACP_syn_III_C DUF5423
Motif
Other DBs
NCBI-ProteinID: AEX47282
Position
complement(2153606..2154514)
Genome map
AA seq 302 aa AA seqDB search
MMGEQGSFDAVALKKYPQLETINHVHHAGNSSGIVDGAALTLIGSEKAGADMGLIPRARI
VATAVNGVEPAVREALAKANLTVDDIDVWEFNEAFAAVVKHAQQNLGIDYEKLNIKGGAM
AMGHPLGATGAMITGAAIDELHRISGRYGLISLCVAGGESGITGIIITPAKKTFFAGGDI
KQMSKATEADAEAMFTMVEHMKESLRLEKLPVPIVAAINGAALGGGFEVALAANHRIAAD
ARGSKIGLPEVTLALLPGGGGVSRVVRMIGIQNALMQVILTGAQMNPQPPSGTTPHVAGP
PH
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgatgggtgagcagggcagcttcgacgctgttgcactgaagaaatacccacagcttgag
accatcaaccacgtccaccacgccggtaattcttccggcattgtcgacggcgctgccctg
actctcatcggttccgagaaggcaggcgcggatatgggactgatcccacgcgcacgcatc
gtcgccaccgccgtcaacggtgtcgagccagctgttcgcgaagcactcgcgaaagcaaac
ctgactgtcgatgacattgatgtctgggagtttaacgaggctttcgcagccgtcgtgaag
catgcacagcagaacctgggcattgactacgaaaagctcaacatcaaaggtggcgctatg
gcaatgggccacccactgggtgcgaccggcgcgatgatcaccggcgctgctatcgacgaa
ctgcaccgcatcagcggacgctacggccttatctcgctgtgcgtcgctggcggggaatcc
ggtatcacgggcattatcatcacccccgcgaaaaagaccttcttcgcaggtggcgacatc
aagcagatgtccaaggccaccgaggccgacgcggaagccatgttcaccatggttgagcac
atgaaggagtccctccgcttggagaaactaccggttccaatcgtggcagccatcaacggt
gcagctctcggcggcggtttcgaggtcgctctcgcagctaaccaccgcattgccgccgat
gcccgcggctccaagatcggcctgccagaggtcaccctcgcccttttgccaggcggcggc
ggtgtctcccgcgtcgttcgcatgattggtattcagaatgcactgatgcaggtcatcctc
accggcgcacagatgaatccgcagccgccaagtggcacgacgccgcacgtggccgggccg
ccgcactag

DBGET integrated database retrieval system