KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0405
Entry
DIP0405           CDS       T00151                                 

Definition
(GenBank) Putative cation transport protein
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Motif
Pfam: E1-E2_ATPase Hydrolase Rrp15p
Other DBs
NCBI-ProteinID: CAE48909
UniProt: Q6NJJ6
Position
370197..372722
AA seq 841 aa
MWSVTDSPLDDAIQEAKSAAQKAGFDTETFAAVQSKEGRTSFAFELEGLGSASSVSELEE
AIEQIEGVDAKIVYPSAMAWISASRTLDPTLIVDAFQQHGVTATLTDSSLRRRLAWTDVE
EGRYRRARARRFGSRVDEESRRFEIARREGFLHKRDETTRVVETTEVLFTARSLMTKARL
FTSIACTIPVLAVSFWRELQFDYWQWALAALSLPVVLYGAWPFHRATIGGARRGMSALDS
ASSVAILMAWGWSIVMMLFSSVGDPTYRAQPKWIAIDPTKFVSGALFFDVACGMTVILLA
GRILVRRARSDLLEDLKRYRPNPSSTVTVVGKNRKTGEVRKEEVAIQKLNVGDDILIAPY
ALIPADGYVVGGASTIDGTALGIGRLKVKVNDHVYAGCVNGSNPLKIRVLQTGHRTWFAG
ITRWVSQASVHQNHADAVATRAASMLVPVSFVIAATDFALWALITNNLNQAFATALAVLG
CVSPVALATSASLAMRKSIEDAARQGVLIQSGETLRVIDTVDTVIFNRVGALSKAGMSVE
KVTADRGENPDLVLRVAGALAMESDHPVSRALVRAAREARDASTDDSIPGWIDVTHSEID
EEGSFRGFVELPVGEEARSVEAVLWRPRSLSALDGRLAAAAESGSSPLVVRWKNKDRGVI
TLFNAVKDDAVDAVDDLEAQGIETMMLSRDTYPVARRYGDSVGVSHVLAGIQPGQKPQTV
RSVRNHGATIAVVGDDSINDCFRVANVGILIDAMSKSSAAIEHPVANVIMLKNDVAPIPR
LFTFARRLNRRIRSNLGFAWVYNVAAIVAAISGVLHPMIASLFMLGATIVIEVRSTWTRN
L
NT seq 2526 nt   +upstreamnt  +downstreamnt
gtgtggtccgtgactgattcgccgcttgacgacgccatccaggaagccaaatccgctgcg
cagaaggcgggatttgataccgaaacttttgccgctgtgcagtcgaaggaggggcgtact
tctttcgcttttgaattggaggggttaggtagtgcctcttcggtttcggagttggaagaa
gcgatcgagcagatcgaaggagtggatgccaagatcgtttatccttcggcgatggcgtgg
attagcgccagtcgcacgttggatccgacgctcattgtggatgcttttcagcagcatggc
gtgacggctacgttgacggattcttcgctgcgtcgtcgattggcgtggacggacgtggag
gagggtcggtatcgccgcgcgcgtgctcgccgctttggttcgcgtgtcgacgaagaatcg
cgccgcttcgaaattgctcggcgcgaagggtttttgcacaagcgcgacgaaaccacacgg
gtggtggaaaccacggaggtgttgttcactgcgcgttcgttgatgactaaagctcgcctt
tttacttctattgcctgcacgattcctgttttagcggtgagcttttggcgggaactgcag
tttgattattggcagtgggcactggcggcgctgtcgcttcctgtggtgctctatggtgcg
tggccgtttcaccgtgccacgattggtggtgcgcgcaggggaatgtcggctctggatagt
gcctcctccgttgccattttgatggcgtggggttggtctatcgtgatgatgctgttttct
tcggtgggtgatcctacgtaccgtgcgcagccgaagtggattgcgattgatcccacgaag
tttgtttcgggtgcactgtttttcgatgttgcatgcggcatgaccgtgatcttgttggcg
ggacgtatcttggtgcgtcgtgcgcgttcggatcttttggaagatttgaaacgttatcgc
ccgaatccgtcgtcaacagtgacggtggtgggaaagaaccgtaagacgggtgaggttcgt
aaggaagaagttgcgattcagaagctcaacgtgggtgacgatatcctcattgctccttat
gcgttgatccctgccgacggctatgttgttggtggcgcttctacgatcgatggcactgct
ttgggcattggccgattgaaggtcaaggtcaacgaccatgtttatgctggttgtgtcaat
ggttctaatccgctgaagattcgtgtgcttcaaactggtcaccgcacatggtttgcgggc
attacgcggtgggtgtcgcaggcaagtgtgcatcaaaaccatgcggatgcggtggcaacg
agggcggcgtcgatgttggtgcctgtctcttttgttattgcggctacggattttgcgttg
tgggcgctgattactaataacctaaaccaagcttttgctaccgcgctggcggtattgggg
tgtgtttctccggtggctctggctacctcggcttctctggctatgcgtaagagcattgaa
gacgccgcccgtcagggtgtgttgatccaaagtggtgagacgttgcgtgtgatcgatact
gtcgacacagtaattttcaaccgagtgggtgcgttgtctaaggcaggcatgtcggtagaa
aaggtcacggcagaccgcggtgaaaatccagatttggtgctgcgtgttgcaggcgcgttg
gcgatggaaagcgatcaccccgtatcccgggcgttggtgcgtgcggctcgtgaggctcgc
gatgcttcgacggatgattcgatccccggctggattgacgtgacgcattcggaaatcgat
gaggaaggtagtttccgcggttttgtggaacttcctgttggtgaggaggcgcgctctgtg
gaggccgtgttgtggcgtcctcgcagcctatcggcacttgatggtcgtcttgctgctgcc
gcggagtcgggtagttctccgttggtggtgcgctggaagaacaaggatcgtggtgttatc
accttgtttaatgcggttaaagatgatgccgtggacgcggtggatgatttggaagcccaa
ggcatcgagacgatgatgctgagccgtgatacctatccggtggcgcgtcgatacggcgat
agcgtgggtgtttctcacgtgttggctggcattcagcctggtcaaaagccgcagaccgtt
cgttctgtgcgcaaccacggtgccacgattgcggtggtgggagatgattccatcaatgat
tgttttcgcgtggctaatgtaggcattttgattgatgcaatgtcgaagagctcggcagct
attgagcaccctgttgctaatgtcatcatgctcaaaaatgatgttgcgcctatcccacgc
ttgttcacctttgcgcgtcgactcaatcgtcgtattcgctcaaacttgggttttgcgtgg
gtatataacgtggcggcgattgttgccgctatttctggggtgttgcacccgatgatcgca
agcctgtttatgttgggtgcgaccatcgtgattgaggtgcgttctacgtggacgaggaat
ttgtaa

DBGET integrated database retrieval system