KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0541Help
Entry
DIP0541           CDS       T00151                                 

Gene name
adk
Definition
(GenBank) adenylate kinase
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
cdi00230  Purine metabolism
cdi00730  Thiamine metabolism
cdi01100  Metabolic pathways
cdi01110  Biosynthesis of secondary metabolites
cdi01130  Biosynthesis of antibiotics
Module
cdi_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:cdi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    DIP0541 (adk)
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    DIP0541 (adk)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cdi04147]
    DIP0541 (adk)
Enzymes [BR:cdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     DIP0541 (adk)
Exosome [BR:cdi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DIP0541 (adk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADK AAA_17 AAA_18 Thymidylate_kin AAA_33 Cytidylate_kin Zeta_toxin
Motif
Other DBs
NCBI-ProteinID: CAE49052
UniProt: Q6NJ71
Position
511081..511626
Genome map
AA seq 181 aa AA seqDB search
MRLVLLGPPGAGKGTQAAILSEKLRIPHISTGDLFRANIGEGTPLGKEAKSYIDAGKLVP
TDVTARMVKARLQKDDAEVGFLLDGFPRTVEQAEILKEMLKGFGVELNGVINYEVAEDVV
VERMLARGRADDNEDTIRTRLQVYRDETAPLIRHYGDDIITIKAEGSIEDINARTLGALG
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgcgactcgtacttcttggacctcccggtgctggcaaaggcacccaagcggctatcctc
tccgaaaagctgcgcattcctcacatctctaccggtgacctattccgtgccaacattggc
gaaggcaccccactgggtaaggaagcaaaatcttatattgatgccggcaagcttgtgcct
accgacgtcaccgcgcgcatggtgaaggctcgcctccaaaaagacgacgcagaggttgga
ttccttcttgacggcttcccacgcactgttgagcaggctgagatcctcaaggaaatgctg
aaaggattcggcgttgagctcaacggtgttattaactacgaagtcgctgaagatgtagta
gttgagcgcatgcttgctcgtggccgtgcggacgacaacgaagacaccatccgcacccgt
ctgcaggtttaccgcgacgaaaccgcaccacttatccgccactatggtgacgacatcatc
accatcaaggcagaaggtagcatcgaggacatcaatgctcgcaccctcggagcactgggc
aagtaa

DBGET integrated database retrieval system