KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0544Help
Entry
DIP0544           CDS       T00151                                 

Definition
(GenBank) Putative secreted protein
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YkuD
Motif
Other DBs
NCBI-ProteinID: CAE49055
UniProt: Q6NJ68
Position
515101..515910
Genome map
AA seq 269 aa AA seqDB search
MICDMPTVVSFLIFLMSVTIVTLMSYKPRHAKPSATRRRVTAVIGATATSAALLTAQPAT
ASAAPLSSGSSATSSINDQLQTIGQQTRDGAWNLRNALISQADALPIEVAAPIKNGIDAT
VNLFFPGLIQERTFVAPPPPPAPAPAPAAPEFDRGSCPPAARACIDLAQQRAWLQQDGRV
VYGAVPISSGRPGWETPQGVFHVNRKVKDEISREFNNAPMPYSVYFTNNGIAFHQDNPNV
MSHGCIHLWHNDAVTFFNTLQYGDMVYVY
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
gtgatatgcgacatgccgacggtggtaagttttctcatatttttaatgagcgtgactata
gttactcttatgtcctataagcctcgtcacgcaaagccgtcggcaacgcgccgtcgtgta
actgcggttatcggcgcaacggccacctcggccgcgttgcttaccgcacagccggccact
gcctctgcagcgccgttaagctctggttcctccgctaccagctccattaatgatcagctg
caaacaattgggcagcaaactcgtgatggtgcatggaacctgcgcaatgcccttatctcg
caggctgatgcgctccccattgaggtagcagcgccaattaaaaacggtatcgacgccacc
gttaacctgtttttcccagggctaatccaagagcgcacttttgttgcgccgccgcctcca
cctgcaccggcgcctgcgccagctgctcctgaattcgatcgtggatcctgcccaccggca
gcacgtgcatgcatcgatcttgcccagcagcgtgcgtggctccagcaagatggccgtgtg
gtttatggtgcggtgccgatctcttcgggtcgtccaggttgggaaacacctcaaggtgtg
ttccatgtaaaccgcaaggtcaaggatgaaatctcgcgtgagtttaacaatgccccgatg
ccatactcggtgtatttcacaaacaacggtattgcattccaccaagacaatccgaatgtg
atgtcgcacggatgtattcacctgtggcacaacgatgcggtgacgttctttaacacactg
caatatggcgatatggtgtacgtttactag

DBGET integrated database retrieval system