KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0546Help
Entry
DIP0546           CDS       T00151                                 

Gene name
rpsM
Definition
(GenBank) 30S ribosomal protein S13
  KO
K02952  small subunit ribosomal protein S13
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
cdi03010  Ribosome
Module
cdi_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:cdi00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    DIP0546 (rpsM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cdi03011]
    DIP0546 (rpsM)
Ribosome [BR:cdi03011]
 Ribosomal Proteins
  Bacteria
   Small subunit
    DIP0546 (rpsM)
  Archaea
    DIP0546 (rpsM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S13 DNA_pol_lambd_f FbpA
Motif
Other DBs
NCBI-ProteinID: CAE49057
UniProt: Q6NJ66
Position
516618..516986
Genome map
AA seq 122 aa AA seqDB search
MARLAGVDLPRNKRMEVALTYIYGIGPARAAQLLEETGISPDLRTDNLTDEQVSALRDVI
EATWKVEGDLRRQVQADIRRKIEIGCYQGLRHRRGLPVRGQRTKTNARTRKGPKKTIAGK
KK
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtctcgctggagttgaccttccgcgcaataagcgcatggaggttgcactcact
tacatttacggcatcggcccagcccgtgccgctcagctgctcgaggagaccggcatctcc
ccagatctgcgcaccgacaacctcaccgacgagcaggtttctgctcttcgtgacgttatc
gaagcaacttggaaggtagagggtgacctccgccgtcaggttcaagccgacatccgtcgc
aagattgaaatcggctgctaccagggcctacgccaccgtcgtggtctgccagtccgtggc
cagcgcaccaagaccaacgctcgtacgcgtaagggtcctaagaagacgatcgccggaaag
aagaagtaa

DBGET integrated database retrieval system