KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0548Help
Entry
DIP0548           CDS       T00151                                 

Gene name
rpsD
Definition
(GenBank) 30S ribosomal protein S4
  KO
K02986  small subunit ribosomal protein S4
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
cdi03010  Ribosome
Module
cdi_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:cdi00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    DIP0548 (rpsD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cdi03011]
    DIP0548 (rpsD)
Ribosome [BR:cdi03011]
 Ribosomal Proteins
  Bacteria
   Small subunit
    DIP0548 (rpsD)
  Archaea
    DIP0548 (rpsD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S4 S4 TyrRSs_C
Motif
Other DBs
NCBI-ProteinID: CAE49059
UniProt: Q6NJ64
Position
517418..518023
Genome map
AA seq 201 aa AA seqDB search
MARYTGPATRKSRRLRVDLVGGDMAFERRPYPPGQAGRARIKESEYLLQLQEKQKARFTY
GVLEKQFRRYYAEANRLPGKTGDNLVILLESRLDNVVYRAGLARTRRQARQLVSHGHFTV
NGKKINVPSYRVSQYDIIDVREKSQKMIWFEEAQENLLDAVVPAWLQVVPSTLRILVHQL
PERAQIDVPLQEQLIVELYSK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggctcgttataccggcccagcaacccgtaagtcccgccgcctccgcgtcgacctcgtc
ggcggagacatggcattcgagcgtcgcccataccctccaggacaggctggtcgtgctcgc
atcaaggagtccgagtacctcttgcagctccaggagaagcagaaggctcgtttcacctac
ggtgttctcgagaagcagttccgtcgttactacgcagaggctaaccgtctgccaggtaag
accggtgacaaccttgtcatcctgctcgagtcccgtctggacaacgtagtgtaccgtgca
ggtcttgcacgtacccgtcgtcaggctcgtcagcttgtttcccacggtcacttcaccgtg
aacggtaagaagatcaacgttccttcctaccgcgtctcccagtacgacatcatcgacgtt
cgcgagaagtcgcagaagatgatctggttcgaagaggctcaggagaacctgcttgacgct
gttgtacctgcatggttgcaggtcgttccgtccaccctgcgcatcctcgtgcaccagctg
cccgagcgcgctcagatcgacgttccgctgcaagagcagctcatcgtcgagctttactcg
aagtaa

DBGET integrated database retrieval system