KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0551Help
Entry
DIP0551           CDS       T00151                                 

Gene name
truA
Definition
(GenBank) tRNA pseudouridine synthase A
  KO
K06173  tRNA pseudouridine38-40 synthase [EC:5.4.99.12]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Brite
KEGG Orthology (KO) [BR:cdi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cdi03016]
    DIP0551 (truA)
Enzymes [BR:cdi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.12  tRNA pseudouridine38-40 synthase
     DIP0551 (truA)
Transfer RNA biogenesis [BR:cdi03016]
 Eukaryotic Type
  tRNA modification factors
   Psudouridine synthases
    DIP0551 (truA)
 Prokaryotic Type
    DIP0551 (truA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_1
Motif
Other DBs
NCBI-ProteinID: CAE49063
UniProt: P60349
Position
519770..520657
Genome map
AA seq 295 aa AA seqDB search
MLLALIAMINGTVRIRLDLAYDGTDFHGWARQGDSDLRTVQKIIEDTLTLVLQRPIDLTV
AGRTDAGVHATGQVAHFDVDPAALETRSIAGDPARLIRRLARLMPDDVRIHNMSFVPAEF
DARFSALRRHYVYRVTTHPRGALPTRARDTAHWPRSVDISAMQAAADALIGMHDFAAFCK
YREGASTIRDLQEFTWHDVSTPQEPQLYEAHVTADAFCWSMVRSLVGACLVVGEGKRADG
FTEHLLGETKRSSSIPVAAACGLSLVGVDYPSDDQLGARAEQARAYRTHDELPSL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
ttgctgctagcattaatcgctatgattaacggcacggtacgcatccgcctcgatctcgca
tacgacggcaccgacttccacggctgggcgcgacaaggcgactcagatctacgcaccgta
caaaaaataatcgaagacacccttacactcgtcctccaacgccccatcgacctcaccgtc
gcaggacgcaccgacgcaggcgtacacgcgaccggacaagtagcacacttcgacgtcgac
ccagcagccctagaaacccgcagtattgcaggcgaccccgctaggttgatacgtcgatta
gcacgattgatgccagacgatgtccgtattcacaatatgagcttcgtaccagcagaattc
gacgcccgattctcagcactacgccggcattacgtctaccgcgtcaccacccaccccaga
ggcgcactacccacccgcgcacgcgacaccgcccactggccacgcagcgtcgatatttct
gcaatgcaggccgccgccgacgcattgatcggcatgcatgactttgcagcgttttgcaag
tatcgcgaaggcgctagcaccatccgcgacctacaagaattcacctggcatgacgtttca
actccgcaagagccccagctctacgaagcccacgtcaccgccgatgccttctgctggtcg
atggttcgctcccttgtcggagcatgcctagtcgtgggggagggcaagcgtgctgatggt
ttcaccgaacaccttctcggagaaaccaagcgctcatcctcaatccccgtagcagcggcg
tgcggtctcagtttggtcggcgtagattaccccagcgacgatcaattaggtgcacgtgct
gagcaagcacgtgcctatcggacccacgacgaattgccttccctataa

DBGET integrated database retrieval system