KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0558Help
Entry
DIP0558           CDS       T00151                                 

Definition
(GenBank) Conserved hypothetical CFP-10-like protein
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WXG100 T7SS_ESX_EspC SOGA Apolipoprotein Laminin_II RasGAP_C
Motif
Other DBs
NCBI-ProteinID: CAE49070
UniProt: Q6NJ55
Position
530237..530554
Genome map
AA seq 105 aa AA seqDB search
MSQGFKTEADVMRNTAHRVDDTNQEVSAELSRLRSIVDGVRASWEGTAQVSFDNLMQRWD
ASAKGLQDALQSISDNIRGNATSFENVEADNQSAFSAVGGQGLAL
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaaggttttaagaccgaagcagacgtcatgcgcaataccgctcaccgcgttgac
gacacaaaccaggaagtaagcgcggaactatctcgactgcgctccatcgtggatggagtt
cgcgcgtcttgggaaggcaccgcacaagtaagttttgacaacctgatgcagcgatgggat
gcctccgccaaggggcttcaagatgccctgcagtccatctcggacaacattcgtggcaac
gccacctcgtttgaaaacgtcgaagcagataaccaatccgcattctctgcagtaggcggt
caagggctcgcgctgtaa

DBGET integrated database retrieval system