KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0569Help
Entry
DIP0569           CDS       T00151                                 

Definition
(GenBank) Conserved hypothetical protein
  KO
K06925  tRNA threonylcarbamoyladenosine biosynthesis protein TsaE
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Brite
KEGG Orthology (KO) [BR:cdi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cdi03016]
    DIP0569
Transfer RNA biogenesis [BR:cdi03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    DIP0569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TsaE RuvB_N AAA_33 AAA_18 AAA_25 NACHT AAA_30 dNK Cytidylate_kin RsgA_GTPase ABC_tran T2SSE cobW AAA_11 RNA_helicase FTHFS
Motif
Other DBs
NCBI-ProteinID: CAE49081
UniProt: Q6NJ44
Position
537967..538461
Genome map
AA seq 164 aa AA seqDB search
MDTTFARSGNIRLETAAETQAFAEELGRHLEAGDVIILDGPLGAGKTTFTQGLARGLNVK
GRVTSPTFVIAREHKSLSGGPSLVHVDAYRLIDDAAGATDPIGALDSLDLETELEDAVVV
AEWGGGLVEQITDSYLLITFDRTTAHIDDPDSEARIVTWKVIEP
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atggataccacctttgctcgtagcggaaacatacgactcgaaaccgccgcagaaacccaa
gccttcgccgaagaacttggtcgtcatctcgaagcaggagacgtaatcattctcgacggc
cccctcggcgcaggtaaaaccaccttcacccaagggttagcccgcggactcaacgtcaaa
ggccgcgttacctcgccaaccttcgtgatcgctcgcgaacacaagtcactaagcggtgga
ccatcgcttgtacacgtcgacgcataccgccttatcgacgacgccgccggtgccaccgat
cccatcggtgcactcgattctctagacctagaaactgagctagaagatgccgttgtagtc
gccgaatggggtgggggactagtcgaacagattactgatagctacctgctcatcaccttt
gatcggaccacagcgcatatcgacgaccccgattcggaggccagaattgtgacgtggaaa
gttatcgaaccctaa

DBGET integrated database retrieval system