KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0575Help
Entry
DIP0575           CDS       T00151                                 

Gene name
groES
Definition
(GenBank) 10 kDa chaperonin
  KO
K04078  chaperonin GroES
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Brite
KEGG Orthology (KO) [BR:cdi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cdi03110]
    DIP0575 (groES)
   03029 Mitochondrial biogenesis [BR:cdi03029]
    DIP0575 (groES)
Chaperones and folding catalysts [BR:cdi03110]
 Heat shock proteins
  HSP10
   DIP0575 (groES)
Mitochondrial biogenesis [BR:cdi03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    DIP0575 (groES)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cpn10
Motif
Other DBs
NCBI-ProteinID: CAE49088
UniProt: Q6NJ38
Position
543376..543672
Genome map
AA seq 98 aa AA seqDB search
MANVNIKPLEDRVLVQISEAETTTASGLVIPDSAKEKPQEGVVVAAGPGRFDGDDRVPMD
IKEGDTVVFSKYGGTELKYNGEEYLLLNARDVLAIIEK
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
gtggctaacgtcaatatcaagcctttggaggaccgcgtcctcgttcagatcagcgaagct
gagaccaccaccgcttctggtttggtgattccagattctgctaaggagaagccacaggaa
ggcgtcgtcgtcgctgcaggcccaggccgcttcgatggtgatgaccgcgttcctatggac
atcaaggagggcgacaccgttgtgttctccaagtacggcggaaccgagttgaagtacaac
ggcgaagagtacttgctgctcaacgctcgcgacgttctcgccatcatcgagaagtaa

DBGET integrated database retrieval system