KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0577Help
Entry
DIP0577           CDS       T00151                                 

Definition
(GenBank) Putative RNA-polymerase sigma factor
  KO
K03088  RNA polymerase sigma-70 factor, ECF subfamily
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Brite
KEGG Orthology (KO) [BR:cdi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cdi03021]
    DIP0577
Transcription machinery [BR:cdi03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     DIP0577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r2 Sigma70_r4_2 Sigma70_r4 Sigma70_ECF HTH_16
Motif
Other DBs
NCBI-ProteinID: CAE49091
UniProt: Q6NJ36
Position
545504..546070
Genome map
AA seq 188 aa AA seqDB search
MNEEVRELERLVPAAATGDKTALQRIISIVYPQVLRYARTRLSGGRHPTPEDVAQEICLA
VATSIAKFVDQGKPFMAFVYGIASNKVADAHRLYSRDLSNPTDEVPETEIDNDTPESFAL
LAAGSNRVQQLLDLLGDKPREILTLRVFVGLSAEETAEIVGSTPGAVRVAQHRALATLRK
AIEQETGE
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgaagaggtgagggagctagaacgactagttcctgctgctgcaacgggcgataaa
accgcccttcagcgcatcatctctatcgtgtatccgcaggtgcttcgctatgcacgcact
cgcctgagtggcggacggcatcccaccccagaagatgtagctcaagaaatttgtcttgcc
gtagctacttctattgccaaatttgtggatcagggaaagcccttcatggcgttcgtgtat
ggcattgcctccaacaaagtggctgatgcacaccgcctgtattctcgcgatctttctaac
cccacagacgaggtgccagaaacagagatcgataacgacactccggagtcatttgccctg
ctagcggcgggaagtaacagagtgcagcaacttctcgatctactaggtgacaagccacgc
gaaatcctcaccctgagggtctttgttgggttatcggctgaggaaacagccgagattgta
ggaagtacgccgggcgcggtgcgtgtcgcgcaacaccgtgcgctggcaacgttgcgtaag
gcaatagagcaggagactggggaatga

DBGET integrated database retrieval system