KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0595Help
Entry
DIP0595           CDS       T00151                                 

Gene name
guaA
Definition
(GenBank) GMP synthase [glutamine-hydrolysing]
  KO
K01951  GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
cdi00230  Purine metabolism
cdi01100  Metabolic pathways
Module
cdi_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cdi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    DIP0595 (guaA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cdi01002]
    DIP0595 (guaA)
Enzymes [BR:cdi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.2  GMP synthase (glutamine-hydrolysing)
     DIP0595 (guaA)
Peptidases [BR:cdi01002]
 Cysteine Peptidases
  Family C26: gamma-glutamyl hydrolase family
   DIP0595 (guaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase GMP_synt_C Peptidase_C26 NAD_synthase tRNA_Me_trans QueC ThiI Asn_synthase ATP_bind_3
Motif
Other DBs
NCBI-ProteinID: CAE49112
UniProt: P60499
Position
562428..564005
Genome map
AA seq 525 aa AA seqDB search
MTQQTSQKHNPVLVVDFGAQYAQLIARRVREANIYSEVVPHTATVEEIKAKNPAALILSG
GPSSVYADGAPSLDPQVLELGIPVFGICYGFQAMTHALGGTVANTGNREYGRTEMTVDGG
ILHADLEETHKVWMSHGDAVSVAPEGFVVTAHSEGAPVAAFECAEKRMAGVQYHPEVLHS
PHGQEVMVRFLTEIAGLEQNWTAANIAEELIDAVCAQVGPEGRAICGLSGGVDSAVAAAL
VQRAIGDRLTCVFVDHGLLRAGEREQVQTDFVAATGAKLVTVDEREAFLNKLAGVTEPEA
KRKAIGAEFIRSFERAVAGILDDAPEGSTVDFLVQGTLYPDVVESGGGSGTANIKSHHNV
GGLPDDVEFQLVEPLRLLFKDEVRAVGRELGLPEEIVNRQPFPGPGLGIRIIGEVTEERL
ETLRAADLIARTELTAAGLDSEIWQCPVVLLADVRSVGVQGDGRTYGHPIVLRPVSSEDA
MTADWTRLPYDVLEKISTRITNEVSDVNRVVLDCTSKPPGTIEWE
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcagcaaacttcccaaaaacacaatccagtcttggttgtagactttggcgcgcaa
tacgcccagctgatcgctcggcgcgtgcgcgaagccaacatctactccgaggtcgtcccg
cataccgccacggttgaagagatcaaggccaaaaacccggcggcgttaatcctgtccggt
ggcccatcatcggtttacgccgacggcgcaccatcgcttgacccacaggttctcgaactc
ggcatccccgtcttcggcatctgctacggcttccaagctatgacccacgccctaggcggc
accgtggccaacaccggcaaccgtgaatacggtcgcaccgaaatgaccgtcgatggcggc
attctccacgctgacctcgaagaaacccacaaagtatggatgagccacggtgacgctgtc
tccgttgcaccagagggattcgttgtcaccgcccactccgaaggtgcacccgtcgcagcc
ttcgaatgcgccgaaaagcgcatggcaggcgtgcaataccacccagaggttctgcactcg
ccacacggccaagaagtcatggtgcgcttcctcaccgagatcgccggccttgagcaaaac
tggaccgcagccaacatcgccgaagagcttatcgacgcagtctgcgcacaggtcggacca
gaaggccgcgctatctgtggtctttccggtggtgttgactctgcagtcgcagcagcactc
gtccagcgcgccatcggcgaccgcctcacctgcgtattcgtcgaccatggcttgctgcgt
gcaggcgaacgcgaacaggtccaaaccgatttcgtcgccgcaaccggcgcaaaactcgtc
accgttgacgagcgcgaagcattcctgaacaagctcgcaggtgtcaccgaaccagaagct
aagcgcaaagccatcggcgcagaattcatccgctccttcgaacgcgcagtcgccggcatt
ctcgacgacgcccccgaaggctccaccgtggactttctcgtccaaggcaccctctaccca
gacgttgtagaatccggcggcggctctggtaccgccaacatcaagagccaccacaacgtg
ggcggcctgcccgacgacgtagaattccaactcgtcgaaccactacgcttactgttcaaa
gacgaagtacgcgcagtgggtcgcgaactcggtctgcctgaagaaatcgtcaaccgccag
cccttcccaggccccggcctcggcatccgcatcatcggcgaagtcaccgaagagcgcctg
gaaacactacgcgcagccgacctcatcgcccgcaccgagctgaccgcagctggcctcgac
agcgaaatctggcagtgcccagtagttttgcttgccgacgtccgctccgtcggcgtccaa
ggcgacggccgcacttacggacatcccatcgtcctacgccccgtctcctccgaagacgcc
atgaccgcagactggacccgactgccctacgacgtgctcgagaaaatctccacacgtatc
accaacgaggtctcagacgtcaaccgcgtcgtcctcgactgcacctccaagccaccagga
accatcgagtgggaataa

DBGET integrated database retrieval system