KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0600Help
Entry
DIP0600           CDS       T00151                                 

Definition
(GenBank) Putative two component system response regulator
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg GerE Sigma70_r4_2 HTH_23 Sigma70_r4 HTH_28 Trp_repressor HTH_40 HTH_7 Sigma70_ECF HTH_24 TadZ_N Terminase_5 HTH_38
Motif
Other DBs
NCBI-ProteinID: CAE49117
UniProt: Q6NJ16
Position
567764..568459
Genome map
AA seq 231 aa AA seqDB search
MKVFLVDDHSVFRAGVKAEISDAVDIVGEAGTVADAIAGINATDPDVVLLDVHMPDGGGV
AVVRSILSQQGIGRNRRFLALSVSDAAEDVISVIRAGARGYVTKTISGAELVDAIRRVHD
GDAVFSPRLAGFVLDAFARPDPVGAGVVNAPESDRAVEEGKPVADPIVDALTRRELEVLK
LLARGYTYKEIAAELFISVKTVETHASNILRKTQQSNRHALSRWAQSHDLD
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtattcctcgtcgatgaccacagtgttttccgggctggtgtgaaagcagaaatt
agcgatgccgtcgatattgttggcgaggcgggaaccgtcgccgacgccattgccggcatc
aacgccacagacccagacgtggtgcttctcgacgtccacatgcccgatggtggcggcgta
gctgttgtacgcagcatcctttcgcagcaaggtatcggaaggaatcgtcgattccttgca
ctaagtgtttcggatgccgccgaggacgtaatttcggttatccgtgctggcgctcggggc
tacgtgaccaagacgatctcgggtgcagaattagtcgatgctattcgccgagtccatgat
ggcgatgcagtgttttcgccacgactcgctggatttgttttggatgccttcgcgcgcccc
gatccggttggtgctggtgtggtcaatgctccagaatctgatcgcgctgttgaggaaggt
aaaccggttgcggatcctattgtggatgcgttgacgcgccgggagctggaggttttgaag
ttgttggctcgtggttatacctacaaagagattgcggcggagttgttcatttcggtgaag
accgtcgaaacgcatgcgtcgaatattttgcgcaagacacagcagtcgaatcgtcatgcg
ctttctcggtgggcacagtcgcacgatttggattag

DBGET integrated database retrieval system