KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0610Help
Entry
DIP0610           CDS       T00151                                 

Definition
(GenBank) Putative ABC transport system secreted protein
  KO
K02073  D-methionine transport system substrate-binding protein
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
cdi02010  ABC transporters
Module
cdi_M00238  D-Methionine transport system
Brite
KEGG Orthology (KO) [BR:cdi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    DIP0610
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cdi02000]
    DIP0610
Transporters [BR:cdi02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   D-Methionine transporter [MD:M00238] [OT]
    DIP0610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lipoprotein_9
Motif
Other DBs
NCBI-ProteinID: CAE49127
UniProt: Q6NJ06
Position
complement(576948..577820)
Genome map
AA seq 290 aa AA seqDB search
MNFTKFRTALSILSVTVVAATGLVACSGGSSDANTIKIGTTDSTKKAWDVWKDKAKEQGI
DLEVVDFSDFSTPNQALSQNRLDVNLFQHLKFLAEYNVKSKSDLVPVGSTEIIPLALFWK
GHDSLDGIEGQSVAIPNDPTNQARAINVLVANKLITLKTPGMSTPTPADVDTAKSKVTLT
PVEAASAPAAYGEGKPAIINNTFLERSGIDAKTAVIQDDPASTEAEPYINVMVTTKENKD
NPRWAQLIELWHTDEVQKALAEDSKGTSVEVKRSPEELQAILDRLEAEVK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcacgaaattccggacagcattgtcgattctttccgtaactgtcgttgcagcg
accggtttggttgcgtgctcgggcggttcttccgatgccaacaccatcaaaattggtact
acggactctacaaagaaggcgtgggatgtatggaaagacaaggcgaaggaacagggcatc
gacttggaggtcgtggacttttctgatttctccacgccgaaccaggcactgtcgcaaaac
cgactcgatgtgaacttgttccagcatttgaaattccttgcggaatataacgtgaagtcc
aagtccgatttggtccccgtgggatcgacggagatcattccgttggcgttgttctggaag
ggtcacgattctcttgacggtattgaggggcaatcggtggcgatccctaacgatcccacg
aaccaagctcgtgccatcaatgttctagtggctaacaaactgatcacgttaaagacccct
gggatgagtactcctaccccagcggacgtcgatacggcgaagtcgaaggtgacgctcacg
cctgttgaggcggcgtcggcgcctgcggcatatggtgagggcaagccagcaattattaac
aacacgttcttggagcggtccggcattgatgccaagactgcggtcatccaagatgatccc
gcatctacggaggccgagccttacattaacgtcatggtgaccaccaaggagaacaaagat
aatcctcggtgggctcagctcattgagttgtggcataccgatgaggtgcaaaaagctctc
gcggaggattctaaaggtacctctgtggaagtaaagcgtagccccgaagagcttcaggcc
atcctggatcgcctcgaggctgaggtgaagtag

DBGET integrated database retrieval system